SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084144 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084144
Domain Number 1 Region: 80-258
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.02e-61
Family Brix domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084144   Gene: FBgn0039274   Transcript: FBtr0084769
Sequence length 298
Comment pep:known chromosome:BDGP5:3R:20900604:20902104:1 gene:FBgn0039274 transcript:FBtr0084769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRKQARQRREYLYNKALTERLKSKQKIQETVVKSINENKAIGSKNVKKSLTAYKSLKYA
DEGVDDRTVNDEYHYAGCEDPKIMLTTSHNPSSRLKMFMKELRLIIPNAQQMNRGNYQLT
TLMHACRANNVTDFLIVHEHRGIPDSLVVCHLPYGPTAFFNISDVVMRHDIPDIGHMSEQ
KPHLIFNNFKTPIGLRTVKILKHLFPVPKENSQRVMSFLNHNDSIIFRHHQYKYVNKELE
LTEVGPRFSLKLYQIKLGTLENIKAADTEWINRPYMNTSQKRLIFSNDPGIINKDTEA
Download sequence
Identical sequences Q9VBY2
FBpp0084144 7227.FBpp0084144 FR45 FBpp0084144 FBpp0084144 7301265___KOG2781 NP_651335.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]