SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084188 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084188
Domain Number 1 Region: 1306-1446
Classification Level Classification E-value
Superfamily PH domain-like 3.02e-40
Family Ran-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1608-1738
Classification Level Classification E-value
Superfamily PH domain-like 3.24e-38
Family Ran-binding domain 0.0000984
Further Details:      
 
Domain Number 3 Region: 2020-2147
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-37
Family Ran-binding domain 0.00015
Further Details:      
 
Domain Number 4 Region: 2534-2672
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-34
Family Ran-binding domain 0.00041
Further Details:      
 
Domain Number 5 Region: 32-110
Classification Level Classification E-value
Superfamily TPR-like 0.000000542
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 6 Region: 1771-1797
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000926
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Weak hits

Sequence:  FBpp0084188
Domain Number - Region: 1892-1917
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000644
Family Ran binding protein zinc finger-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084188   Gene: FBgn0039302   Transcript: FBtr0084813
Sequence length 2695
Comment pep:known chromosome:BDGP5:3R:21075316:21084394:1 gene:FBgn0039302 transcript:FBtr0084813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTTRKEVDAHVHKMLGKLQPGRERDIKGLAVARLYMKVQEYPKAIEYLNGYLRVRDDAV
GHNMIATCYSRLNPPDVTEALQHYQRSIQIDPRQSEVVIDACELLVKENNASITECARYW
LDQANSLDLSGNKQVFNLRMRVNLADSNGERDDTSGGDGEQNTLEILMYKELQARPQDVN
IRIQLLRSYVEKMKIDQAFNYALKTELESKNCTSQSNEWYEQIWMVLFKIEMAKDVKKNW
RFWHFALHTLDRLVQLSLEGSGLADSSKQLFRLDQYLFKFSTSIERSGDAPQRDLHQACI
DHFTGQLLLHAVTLIFKREVLANKNKWMSTLRSALPLLLLGYQVRPIDDSSTNQWIKHCD
AEQKQLIQMWRPQGAFRCAQLGRTLLGCLDRSQMEIKNDRENAEFDENKNSGNSMPGLFA
DSEELLASAHQQCLDKSWRSQIYQQLFTHAEHKLKDTSSHLVRNLRLQLPLFEWPNLAHI
ENYELQALVLPPHSLAQHVYLALGTDPNKLGDAPRVVFYEGFQRDVKQNLNYCGQDSISQ
VDVDLYLYATTIQTRRKLQIQREVYDSSNLGNRNAAARPHMMPFANLVGQLGAPEQSNWW
DLVVRLNSNQLITEGNRAEQRAQLQHGLEAVRGVNGPKADAIIIFQLGKILNSRSDRSSL
EARIDTLYRQGFSILRHQHNQQMESYVRVFKYGSAGSTAAWQDLQSLAEEAVTYFSEKMF
RIGQYEQFLDEVRGLHLPMAYFLQSEACHHLEESSKLPRTSRDRYSERRRECLQKTQKLI
KNDDKHPLIAAMHRHQQDRNSRGIDNSFGSPDVHNNSSAYEDAEDDFYSHAAFSANRSRR
QLEVTPVTPIVMAQPSQEMEQAVKQISKSLCVLKDDVSVGMEAMRQDIKVLTEKFTGLED
LLKKIKISSRDTPTRDVDPAAALGLDDLFIIEDALAEHQQQQQHQQQQSHNQGAIHPVVP
NPYTSGFYNGMPNTPSAQERFLQGPYGSPMFNQNQMYNYYAAQAQAQAQAQFLRTPPAPG
SIPPPNMFGPRNPNFGLPSMFPPPTVPSVAPYIDAMGNFTQPPPSLIPPPAQPAAPPAPL
NILESKPVVALPTPGFFNTTTPVFGASPIQVPQSKPLTVPTVPIPSTAPAPPIAGTVNPP
ATTAVPPPVHIPQVAPSVPAQPPAPAPVSVPSMFNRALNNQPVEKEPPANVVITSSDPLP
KPTTASVQPTLSVTIPAQHIKPSLVQAPEQPAQSAQPAQPSVSGVGSLSFNFGSKSSESP
FSFKTQVAKAAAEKQKEQEEAEQNQSGATDPNKTLPQDTSADDYDPRPDFKPIIPLPDEV
EVRTGEEGEDIKFTSRAKLFRYVDKEWKERGTGVIKILCDKATGVSRVLMRRDQTHKVCA
NHTITADITINVANQDKDKKSLLWAANDFADEQVTLERFLVRFKTGELAEEFRVAFTKAS
EAAKSKETVKPTVNTAEKGSTATAPAAFKSFVTSTPAANSLINKPQEQTKTQPNPDPPAT
AAKSLFGTLSVSAAPATSAPASATPFASFSFTPNGSSGFGTSTASPFGNLSFGTASAVGS
GNNTTLFTTALIKDNTVQGKTLQQESQLNKSNSSDAEEEYVPTAQFVPVIALPDIVEVVT
GEENEDVLFEHRAKLLRWDKEANEWKERGLGNMKLLRDRTDPNKVRLLMRREQVHKLCCN
QRLLPETKFTYATNCKAAVTWGAQDYSDEELTTALLAVRFKSQDICQQFLEAVQKAQQSI
GNEPKKEEVPSAAGEKEKPIKGFGDAFKPKAGSWNCQACYTNNGQDQLYCLACQEPKDAT
VPPKQSGLDQGNALNLTTSSSNKFSFGFASSATLPATGGFSFGGATQPKEKPAVAVVTAS
ASAPTSVQTAALGFGKSSMTSGFGDAFKPAVGSWSCSACYVNNPGESLYCSACDAPKNDT
VPQKEKSLGSGLNLPPTSKFSFGFGAAAAGDKDQAGDGATFNFAAMPAAVAPTTSIGSSS
FTFSMTKPKPDQQQPNSTAAKEDEDNDSQEVEEEENNTYFSPVIPLPDKIDVKTGEEDEE
LLYVHKAKLYRLNESDWKERGLGDVKILRHRQTKKLRVVMRREQVFKICLNHVLNENVVY
REKTETSWMFAVHDFSEGESVLERFTLRFKNKEVAQGFMEAIKNALNETAKPIEDSPVVG
SVSQSTEANKPSQKNDGAAKSRGGESEVLDVGKTSSPLAKPNDYQTPATILFKGSSLSRN
NSSASEASKTPSSAFIFGSTDKSEPGKDAGPLANLQKLASGEGQGNVLGSIFRSGSSNEN
SSDGSVKFFFGGGNKAAEQQKKDSSESVFGGNKADSQSPATQEAPKLAFGGIAAPVFGDA
NPFGGHKVNLQKSDGKEEPKSIIGGTPLLFGGSNAFGIPKIETQSPAKDFVFGSAPAFGQ
MATFSFTAAKNEKEKDITSNNTTDLKAEGKEKKELVPETTSTFADLAKTGSTFADLASNP
GGTFADLANKTGNDFANLSANSQGTTVGFNKSAGGGFYNLTHQNAFKNFESPQATEECDD
DGDATTDDNYDPHYDAIVELPDEIVVTTGEENETKLFGERAKLYRYDAESKQWKERGVGE
IKVLEHPELQTFRLIMRQEQIHKLVLNMNISASLQMDYMNAQMKSFLWAGYNYAVDAEGK
VDTEGVLERLACRFAKEEIASEFLNTVNSCIKRAKALQGDEENKNDDAPEEQASS
Download sequence
Identical sequences 7227.FBpp0084188 FBpp0084188 FBpp0084188 NP_651361.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]