SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084220 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084220
Domain Number 1 Region: 61-401
Classification Level Classification E-value
Superfamily L domain-like 1.59e-44
Family Ngr ectodomain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084220   Gene: FBgn0039332   Transcript: FBtr0084846
Sequence length 471
Comment pep:known chromosome:BDGP5:3R:21206785:21208522:-1 gene:FBgn0039332 transcript:FBtr0084846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLWWLLSLQVVLILPPSYHLATPSSGSGQLRRLWLQDHCSAGICTNVVIGRSDYVILS
QAPIGGTTMLTFLNSSIAKIPHLLFDTFPDLQVLRMENCSLETFEKPQFEGASNLMSLFL
GYNRLKDIPKNIFLGADNLATLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQISLGV
FSGMRKLMDLNLAGNRLDALPRGVFDRNLNLTKLNLARNRFTAFESELLKLQPVFTQLDI
SGNIFQELTLNFTMLDVAIAHSCDLRRLTVYGVIHELDLHNNSLREMPHIPLAANVSSLD
LSHNPLGNLQGNPLRRFTSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKIT
IFDSLKALQYFYFQQNNWNCDFLQLLMSSFVKRKDISFMEDITAPELVDDYVDGIACWYE
SDKQSKKCESGGSDAAMELSVVRNEIKTFTELVEKKFVKVYRMLEEMKMKL
Download sequence
Identical sequences Q9VBR3
7227.FBpp0084220 FBpp0084220 NP_651393.1.81976 FBpp0084220 FBpp0084220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]