SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084258 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084258
Domain Number 1 Region: 505-676
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.51e-30
Family Cyclophilin (peptidylprolyl isomerase) 0.00022
Further Details:      
 
Domain Number 2 Region: 132-190
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000311
Family B-box zinc-binding domain 0.0059
Further Details:      
 
Domain Number 3 Region: 6-90
Classification Level Classification E-value
Superfamily RING/U-box 0.00000173
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084258   Gene: FBgn0039347   Transcript: FBtr0084884
Sequence length 680
Comment pep:known chromosome:BDGP5:3R:21444136:21446401:1 gene:FBgn0039347 transcript:FBtr0084884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESIQVPKELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQRNTDHNSSECICNL
CGYRTQLDGQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNW
VEDINVESFLATSAEHCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQVDYHDLI
SQLLNSELRKIKSTAVHAKELATHEMDLLRELCEACYRVQLHVKREMLEHHSSMVAASMI
GWHRLAERDLHRVGRLTGAKMLQVLAHLATQRQRYERQLDQVHFQCRMQAAIQENGMQVL
DFETLNNRIARLRSHRRPGAIPANVGPPQALILTNYCVYAYWCEMQREMIPPRHRNLTPD
PELLPEPRRAVVPPHFNNSLREVELLDYVQQIELEQFRTLSQPPYDGSHESSSSPNSSSS
TNSQSNYIALDTEYGLRELVRQLQQQPQQVQQEQQQQQQQVHQLTHSIYQPDAILVNSVE
PQLIGQQSHDHHRQDGGTSSSVSIVRQPIVHCYPIYFLDMEIAGELAGRVLIEVRSDAAP
RMADNFGALVRHERGYGYRGCTVFQAWGGESIITGDFESQNGRGGHSAFESRYFLPDETG
LPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNEMRSFTAIFGFIVQGIELVDRIAASGNA
LGRPALRSIIRNCGEYHLNQ
Download sequence
Identical sequences Q8IMS5
FBpp0084258 NP_001303432.1.81976 NP_651406.1.81976 FBpp0084258 7227.FBpp0084258 FBpp0084258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]