SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084273 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084273
Domain Number 1 Region: 426-727
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.19e-41
Family Rhodopsin-like 0.0012
Further Details:      
 
Domain Number 2 Region: 129-395
Classification Level Classification E-value
Superfamily L domain-like 1.94e-39
Family Ngr ectodomain-like 0.023
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084273   Gene: FBgn0039354   Transcript: FBtr0084899
Sequence length 765
Comment pep:known chromosome:BDGP5:3R:21491531:21502938:1 gene:FBgn0039354 transcript:FBtr0084899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYGRSIAVGFCLMTVVLLLAAVIFYLSLGPCPAASFACDNGTLCVPRRQMCDSRNDCAD
SSDENPVECGLLYGSKEIADKIVRNAIEKKQQRLISAVSNASGADSTTSMVPRNQSLTLN
MTCDIVTYPKACQCGQGTILYCGRYAKLRRFPRLSSEVTNLIIIRNNLTLRDNIFANFTR
LQKLTLKYNNISRVPLGSFSGLFHLERLELSHNNVSHLPHGVFLGLHSLQWLFLVNNHLH
HLPVEQLRFFRRLEWLVLSRNRLTLRNVQLPKIPTLYEVYLDFNRIEYIGEETFSQLDNL
HLLDLQHNLITHIHGRAFANLTNMRDIRLVGNPIKELSGETFLHNTRLEALSLALMPIHI
SSSLMEPLNISFLNLTGIRYDHIDFEAINSMRNLTYIIYDRFFYCSMTPRVRMCKPSTDG
VSSFQDLLSKPVLRYSAWVMATLTIAGNVLVLWGRFIYRDENVAVTMVIRNLALADMLMG
FYLVTIGVQDYRYRNEYYKVVLDWITSWQCTLIGTLAVSSSEVSMLILAFMSLERFLLIA
DPFRGHRSIGNRVMWLALICIWITGVGLAVAPVLLWRTSTLPYYGSYSGTCFPLHIHEAF
PMGWLYSAFVFLGVNLLLLVMIAMLYTALLISIWRTRSATPLTLLDCEFAVRFFFIVLTD
FLCWVPIIVMKIWVFFNYNISDDIYAWLVVFVLPLNSAVNPLLYTFTTPKYRNQIFLRGW
KKITSRKRAEAGNGNVATTTTGTATGSSQHPDDFTIFAKAAMRCH
Download sequence
Identical sequences Q9VBP0
FBpp0084273 NP_733115.1.81976 7227.FBpp0084273 FBpp0084273 FBpp0084273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]