SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084296 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0084296
Domain Number - Region: 134-216
Classification Level Classification E-value
Superfamily Respiratory nitrate reductase 1 gamma chain 0.0288
Family Respiratory nitrate reductase 1 gamma chain 0.044
Further Details:      
 
Domain Number - Region: 96-150
Classification Level Classification E-value
Superfamily RING/U-box 0.0494
Family ZZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084296   Gene: FBgn0039368   Transcript: FBtr0084922
Sequence length 276
Comment pep:known chromosome:BDGP5:3R:21601010:21601928:-1 gene:FBgn0039368 transcript:FBtr0084922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIVNDWCREYANLYPKKAVSIGHPLSVIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFFV
ISAIFTTYNILGNLLACYRTSSAVKSLPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCA
LCKCCILKRDHHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRM
KAGFGNTVKSLSYFRYVCLILNIFALGFPALMLRFQVQILKLNSTYYQISSRHHDLGFRN
NCQLIMGQRGLWTFISPSLRSPLPHDGTHWKIKQCF
Download sequence
Identical sequences Q9VBM6
NP_651426.1.81976 FBpp0084296 FBpp0084296 7227.FBpp0084296 FBpp0084296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]