SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084298 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0084298
Domain Number - Region: 110-148
Classification Level Classification E-value
Superfamily RING/U-box 0.0512
Family ZZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084298   Gene: FBgn0039366   Transcript: FBtr0084924
Sequence length 299
Comment pep:known chromosome:BDGP5:3R:21599056:21600121:-1 gene:FBgn0039366 transcript:FBtr0084924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKISHVFVQLRGIMQSQVQMQTINIPRRVGAIKSWTDIMGVSINVCIILFFYFFEAFYVM
PQFLGLFGQAVHFLVTTWIVYNILENLRLCVTTLNTVDSLPPQMQQPMKGEEHLWHFCKI
CQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNF
MLAHKHGVGFFDLVKANYIIFNAYMNPGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQV
VTVIKNSVMHDYSDRTYDLGLGNNLTLILGSRRLWTCLSPNIKSPLPHNGTRWKSKRAV
Download sequence
Identical sequences Q9VBM8
FBpp0084298 7227.FBpp0084298 FBpp0084298 FBpp0084298 NP_001287532.1.81976 NP_651424.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]