SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084491 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084491
Domain Number 1 Region: 19-83
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000371
Family Variant RING domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084491   Gene: FBgn0039498   Transcript: FBtr0085121
Sequence length 294
Comment pep:known chromosome:BDGP5:3R:23066989:23068052:1 gene:FBgn0039498 transcript:FBtr0085121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNVAAPQASAGGDSTELERCCWICFETDKEAGRQAWVNPCLCRGTNKWVHQSCISLWI
DEKTRINNNLQAVSCPQCQTEYTIAYPNLWIFDRALELTNDLILTNLYNCLANVFTVVFA
YWSAVSFGAKTYLQITGQEGHVHQIIQSGDLLVVLVGFPLISVVLILGRLIPWEDALLRF
IRICYSLLRSLSMMCLGRKYDHQTEPYPSAPMTEYSASRVVCGAILLPTISMYVGRVLYS
SVDDRLQQTLLGGLTFIAIKGFLKMYLMHSQYICRMKRRVLDYTKENLAEADGH
Download sequence
Identical sequences Q9VB61
7227.FBpp0084491 FBpp0084491 FBpp0084491 NP_651547.1.81976 FBpp0084491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]