SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084545 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084545
Domain Number 1 Region: 838-949
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.14e-38
Family MBT repeat 0.0000397
Further Details:      
 
Domain Number 2 Region: 954-1073
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.08e-34
Family MBT repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 1035-1135
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.11e-30
Family MBT repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 1296-1369
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000162
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0084545
Domain Number - Region: 1140-1177
Classification Level Classification E-value
Superfamily CCHHC domain 0.00209
Family CCHHC domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084545   Gene: FBgn0002441   Transcript: FBtr0085175
Sequence length 1477
Comment pep:known chromosome:BDGP5:3R:23092047:23098995:-1 gene:FBgn0002441 transcript:FBtr0085175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLSMASAEAKQLQRNISLSMSPANGGVISPSTANCNGVASASGGNPNPNSLLTLAPRK
EELRFLPLAPMGGNKTCNITISNVQPMKSKLKSVNIVPNSIKSAGAGATVGSADAPLFQL
VPSPSNPSQPLVAILAPNRKTTLLGGGASNGQPVVIRSGTPLHKNSLTVETSNKPIQPGG
SAAAAAVGGGTGGAPLTLVGKTVVPPKIQAATPVQIPSTGPGAQVSLLANPLKPRAPLIL
SKVAVDKLRLKFSQVKSNPNALVLGKANHVKKLLTSPNPSGEDKTRSTQKNNKQNTSASQ
LKPVVAPKTAMPIATEVPTADNNKMSLIKSKPVAIKAVPLPSQEAPIVPAVAPVVTSPEK
VDVKPTAKPSIKTAPKPTPKPLEMSVNGPAKEKKAPAKEQKQKTMDKPPVVKEIAQHTPC
GPKELPKLKRSKSFVSNHPASPVANNERRHSVAIMAKEVDVIEQPSAAIETITIEDDDES
EEEQQKPEIKKTPKQNQKPEKQEAPKKKQIPMPILPAGITISTTSTAKKKAVRKNSSVTT
ISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSREDFERSLRCDEQVPQT
PPKSSSSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKANDHDANPSPSSKTNDFKKSMM
QNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPS
ACVHPLLYLCQRCNFHGPAADFLAPHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTA
GTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFL
NPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQ
DIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGF
AVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEG
RQQLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIR
PATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSVM
PCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPENIRRGWAKKT
KRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDE
RSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDI
AKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIAVVCKFDSKNIELES
NTAGPIQREMDTPVSAIKQLPEQSQTNGYKTDHDQELSESGDDDDDEDVMLDSDDFLSVK
PSCLVIDEDADGDGDCESDGDVAMVPMEVRTPLRTSS
Download sequence
Identical sequences Q9VB52
7227.FBpp0084545 FBpp0084545 FBpp0084545 FBpp0084546 FBpp0084545 FBpp0084546 NP_733209.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]