SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084614 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084614
Domain Number 1 Region: 27-101
Classification Level Classification E-value
Superfamily RING/U-box 3.98e-17
Family RING finger domain, C3HC4 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084614   Gene: FBgn0003330   Transcript: FBtr0085245
Sequence length 435
Comment pep:known chromosome:BDGP5:3R:23506153:23507751:-1 gene:FBgn0003330 transcript:FBtr0085245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLDPAPNKTWELSLYELQRKPQEVITDSTEIAVSPRSLHSELMCPICLDMLKKTMTTK
ECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSREEYEAIQE
KVMAKFNQTQSQQALVNSINEGIKLQSQNRPQRFRTKGGGGGGGGGGNGNGAANVAAPPA
PGAPTAVGRNASNQMHVHDTASNDSNSNTNSIDRENRDPGHSGTSAASAITSASNAAPSS
SANSGASTSATRMQVDDASNPPSVRSTPSPVPSNSSSSKPKRAMSVLTSERSEESESDSQ
MDCRTEGDSNIDTEGEGNGELGINDEIELVFKPHPTEMSADNQLIRALKENCVRYIKTTA
NATVDHLSKYLAMRLTLDLGADLPEACRVLNFCIYVAPQPQQLVILNGNQTLHQVNDKFW
KVNKPMEMYYSWKKT
Download sequence
Identical sequences Q9VB08
FBpp0084614 NP_477509.1.81976 7227.FBpp0084614 FBpp0084614 FBpp0084614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]