SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084637 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084637
Domain Number 1 Region: 4-55
Classification Level Classification E-value
Superfamily RING/U-box 0.000000379
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Weak hits

Sequence:  FBpp0084637
Domain Number - Region: 57-126
Classification Level Classification E-value
Superfamily Lipase chaperone-like 0.00314
Family Lipase chaperone LifO-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084637   Gene: FBgn0051053   Transcript: FBtr0085268
Sequence length 219
Comment pep:known chromosome:BDGP5:3R:23753077:23753896:-1 gene:FBgn0051053 transcript:FBtr0085268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRIHCNKCFRRRNVEPTLIFHMTQCQHVLCASCLSESSTDKKCPLCKRDLRAIPIDKNL
PPNVAQYFEDPLRFQQLYRKISKFQADQRASDNLGFYRQMQEHEKNESRLKGFCKMEAQF
NQQIQKEKERIAELRAYIKYHEEEGLKEWPHATGVEKPWSNQARGLRPRTPSVTTSDNTQ
SDEHMTTFCLDSDIDCLEEDEPRRYVKKTFNGNIKDFHI
Download sequence
Identical sequences Q8IMM9
7227.FBpp0084637 FBpp0084637 FBpp0084637 NP_733236.1.81976 FBpp0084637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]