SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084692 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084692
Domain Number 1 Region: 623-908
Classification Level Classification E-value
Superfamily TPR-like 1.99e-43
Family HAT/Suf repeat 0.0077
Further Details:      
 
Domain Number 2 Region: 313-500
Classification Level Classification E-value
Superfamily TPR-like 8.35e-34
Family HAT/Suf repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084692   Gene: FBgn0039600   Transcript: FBtr0085323
Sequence length 1009
Comment pep:known chromosome:BDGP5:3R:24637837:24643076:1 gene:FBgn0039600 transcript:FBtr0085323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQEEEEPFRGTNTAEAPALEPQFEETQHQIEDDVEMLPAEAAGVDEKSSSFPFGTVAEL
HSETSDDIKETRGQAGVDTLLASLAGDNANSLPSVGGNDESDNVKKADFEYNVDSLQPQM
EKMNSSEDSSSQHAIAEDLADADTSNATIVNTEIVSEDELPLPSKPEINDAEEVSDEELP
APQRAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHESSTK
DKSSEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNKDKEK
ERKKLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWR
KYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYERAVK
ACGLEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGYNGHFDNFQDLINQHDVT
ITLANEEVIRLRKDFHERQQSKSSKSSSKHRRDSSSSSKDKDSKEREREKDKDKDKDKDK
EKRETVGGGVGKSPKDTSETQVDESDSTTDLTTESESSHAASKPAMQIDFSDLSTLNDEE
VVSIRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPLERAQLKNWKDYLDFEIE
KGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHHPDK
PSLHLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCRELYKH
YIESTKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERDPANTRVALQMIDLCLQR
PKVDEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGSTARGLQDAQRALQQALTK
AKEAQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQQNT
AAAYPSQTPQQASYDSYYNQWGYGSGGASANSGGSGYNYGQWSGYGNYY
Download sequence
Identical sequences NP_001097957.1.81976 NP_651634.1.81976 NP_788753.1.81976 FBpp0084692 FBpp0084694 FBpp0112211 FBpp0084692 FBpp0084694 FBpp0112211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]