SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084693 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084693
Domain Number 1 Region: 640-925
Classification Level Classification E-value
Superfamily TPR-like 1.63e-43
Family HAT/Suf repeat 0.0068
Further Details:      
 
Domain Number 2 Region: 330-517
Classification Level Classification E-value
Superfamily TPR-like 9.1e-34
Family HAT/Suf repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084693   Gene: FBgn0039600   Transcript: FBtr0085324
Sequence length 1026
Comment pep:known chromosome:BDGP5:3R:24637826:24643076:1 gene:FBgn0039600 transcript:FBtr0085324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEGENVVMESPGRRTRSGRKAASPAASLPTRSTRRTSKRNVQLSDHEEEAEEQVVMVQ
EEEEPFRGTNTAEAPALEPQFEETQHQIEDDAGVDTLLASLAGDNANSLPSVGGNDESDN
VKKADFEYNVDSLQPQMEKMNSSEDSSSQHAIAEDLADADTSNATIVNTEIVSEDELPLP
SKPEINDAEEVSDEELPAPQRAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENES
VKSTEDKDASSHESSTKDKSSEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERD
KDKEKDKDKDNNKDKEKERKKLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAARE
AYDTFLSHYPYCYGYWRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSN
HGDDETFVRSQYERAVKACGLEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGY
NGHFDNFQDLINQHDVTITLANEEVIRLRKDFHERQQSKSSKSSSKHRRDSSSSSKDKDS
KEREREKDKDKDKDKDKEKRETVGGGVGKSPKDTSETQVDESDSTTDLTTESESSHAASK
PAMQIDFSDLSTLNDEEVVSIRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPL
ERAQLKNWKDYLDFEIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVD
LVRDVYRRACRIHHPDKPSLHLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRIN
VERRRGALDKCRELYKHYIESTKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERD
PANTRVALQMIDLCLQRPKVDEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGST
ARGLQDAQRALQQALTKAKEAQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAV
AGYNYGAANPYYGQQNTAAAYPSQTPQQASYDSYYNQWGYGSGGASANSGGSGYNYGQWS
GYGNYY
Download sequence
Identical sequences FBpp0084693 FBpp0084693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]