SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084911 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084911
Domain Number 1 Region: 477-800
Classification Level Classification E-value
Superfamily L domain-like 3.4e-59
Family Internalin LRR domain 0.057
Further Details:      
 
Domain Number 2 Region: 234-558
Classification Level Classification E-value
Superfamily L domain-like 6.12e-55
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 3 Region: 711-1015
Classification Level Classification E-value
Superfamily L domain-like 3.51e-37
Family Internalin LRR domain 0.028
Further Details:      
 
Domain Number 4 Region: 108-271
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 1.05e-24
Family Outer arm dynein light chain 1 0.0033
Further Details:      
 
Domain Number 5 Region: 934-1169
Classification Level Classification E-value
Superfamily L domain-like 2.99e-16
Family Ngr ectodomain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084911   Gene: FBgn0039728   Transcript: FBtr0085545
Sequence length 1392
Comment pep:known chromosome:BDGP5:3R:25809174:25816514:1 gene:FBgn0039728 transcript:FBtr0085545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAWKQLPNGGRFLLLLLACIAHLGHPILAWRPCPELSPALRLPCRCNVVPFAATGQLGA
VAMDCDRVVFHGDAPQLPYGAPIVAYTQRHSGQQVLPAQTFGQLKLTIEELDLSYNLIRR
IPEKAFDGLKDSLNELRLANNLLGDNLNPIFSTAELHVLKNLRLLDLSGNKIKLIEEGLL
KGCMDLKEFYIDRNSLTSVPTNSLNGPSALRHLSLRQNQIGSLLADSFNAQRQLEIIDLR
HNVIRSIDSLAFKGLQKIREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVAL
AAVPGLKHLNLSSNMLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLS
LNSLRTIEDDALEGLDSLQTLIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSAEIL
GSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLSGNSLAVINADTFAGLESTLMAL
KLSQNRLTGLGGAPWVLPELRSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGA
LFKPLDRLQVIDLSGCNIRQISGDLLAGLQDLKHIYLNDNQLQELQDGSFVNLWNISSID
LSNNRIGSIRSGAFVNVMKLQKLDLHGNQLSAFKGEYFNTGTGIEELDISDNQLSYLFPS
SFRIHPRLREIRAANNKFSFFPAELISTLQYLEHIDLSHNQLKTIEELDFARLPRLRVLL
VANNQLDMVSEMAFHNSTQLQILDLAHNNLDRIGERTFEGLVRLEQLNLEGNRLSELSDG
VFERTKLQMLENINLAHNRFEYAPLNALQRQFFFVSSVDLSHNKIKELPGDDSIMVNIKR
IDLSFNPLSSKAVHNVLNEPKTVRELSLAGTGIENLELLETPFLQFLNLSHNKLKNVKPE
VFQRVTLLETLDLSSNQLESLEDLSMAWPQLQVLQSLDVSNNSFEIVSQSNFGKLEMLRS
LRLSHLPQCTRIEKNAFKQLPNLVSLEAYDLPLLGYLDLQGILELLPGLEVLDIEVKDSS
IGSEQIQPLKHPRLKSLGIRGDRLKSISSGTLAGLKSNDLSVQLRNTSLNALPPALLFPV
PRSSHLSLNVEGSKITVLVPQFLNALEDRRASLQLQGLASNPIVCDCNARALRRWLPSSG
MPDVTCASPAYLLNRKLIEVGDDELTCDARRMTSSTSRPTASVPHLLKTSSQLVTRSSST
TEEPLIIWSLEPTQPPSLKKMKTKAPLMKAQSPIISNDDTLIIGIVGGVVAFIAILIIII
CIIRLRMSNAEYQQNATMIGIPAGMQMGAHNAAYNYKNGAGAALYAVPPYHATLPHKAAS
IHQSSQNLSQRQQQQQQQQQVAAAAAAYSTMSRMSYFSGAGGGNGDGAESLTHQHPHQHQ
PYIIYSDDKAYR
Download sequence
Identical sequences Q9VAD1
NP_651754.1.81976 FBpp0084911 FBpp0084911 7227.FBpp0084911 FBpp0084911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]