SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084991 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084991
Domain Number 1 Region: 218-302
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000106
Family U-box 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084991   Gene: FBgn0039767   Transcript: FBtr0085627
Sequence length 486
Comment pep:known chromosome:BDGP5:3R:26251382:26253998:-1 gene:FBgn0039767 transcript:FBtr0085627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLINFLNPKLKPSVETDAVCEDGYTAANLVADDVEQLERGFMCFAVCKPPIEIVFDFP
KAVDMKVIKLWPSCGALRSTAFELHGRHDGIWERVAFVRDLGRGVDSVTFCYQSDYNSRS
SSNSEQSEKVFFFKSAHKILASTNSVKVVIRATERCPPVLRKVQMWGLPARSLDKADREL
VKTIWSEISDPYGQRDAAQTPTGQRSPPRNVPELRDQSTLSIPEEFLDSITWELMIFPTV
LPSGKVVDQSTIDKHAEEEAKWGRQPSDPFTGLEFNAQRKAILHLALKARIEKFLMENSE
HFKAVPRSLGTSRQRRRHASQFASSTCQPGQISPAAGTYSALSNAYKQQQRKSRATATAT
SSSAASFGGSPHSPPAAKRARHSQHGSACATVTSATTSIDQAIQQALQKVTRFSQLPSNS
SAGSGSSSAPPASCINCRSAQFGYEIRTCRHLVCRECLVLLSQDQQCVCKVFFRCADVER
YHKLDP
Download sequence
Identical sequences Q9VA79
7227.FBpp0084991 FBpp0084991 FBpp0084991 NP_001287613.1.81976 NP_651790.1.81976 FBpp0084991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]