SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085139 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085139
Domain Number 1 Region: 707-1074
Classification Level Classification E-value
Superfamily RNI-like 2.2e-46
Family Rna1p (RanGAP1), N-terminal domain 0.055
Further Details:      
 
Domain Number 2 Region: 41-396
Classification Level Classification E-value
Superfamily L domain-like 3.63e-44
Family Internalin LRR domain 0.06
Further Details:      
 
Domain Number 3 Region: 283-687
Classification Level Classification E-value
Superfamily L domain-like 2.61e-43
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 4 Region: 1020-1236
Classification Level Classification E-value
Superfamily L domain-like 0.000000000972
Family Ngr ectodomain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085139   Gene: FBgn0000313   Transcript: FBtr0085778
Sequence length 1315
Comment pep:known chromosome:BDGP5:3R:27029902:27036452:-1 gene:FBgn0000313 transcript:FBtr0085778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLEFFFKFGYAFLTITLMIMIWMSLARASMFDREMEETHYPPCTYNVMCTCSKSSTDLG
IVHCKNVPFPALPRMVNQSKVFMLHMENTGLREIEPYFLQSTGMYRLKISGNHLTEIPDD
AFTGLERSLWELILPQNDLVEIPSKSLRHLQKLRHLDLGYNHITHIQHDSFRGLEDSLQT
LILRENCISQLMSHSFSGLLILETLDLSGNNLFEIDPNVFVDGMPRLTRLLLTDNILSEI
PYDALGPLKSLRTLDISHNVIWSLSGNETYEIKASTKLNLDNLHLEYNHIEVLPPNSFKY
FDTVNRTFFDGNPIHTLREDAFKPARIREIYMRYCGLTNISPVAFDSLVNSLQILDLSGN
NLTKLHHKLFNNFDVLRVISMRDNKIKIQKPTETFNAVHYTLLKLDLSGDRNDPTNLQTL
RNMTRMRNMRSLSISRLGSSSVGPEDFKDFGVELEDLQITRASLSGIQSHAFKHVRGLKR
LDFSENGISSIENDAFHEIGHSLISLKMSHGYSGSALPAEPLRHLTSLQELDFSNNHISS
MSDTSFHFLKNLRLLELHDNRIEQVLKGTFQGDIHSKLEEISLRFNHLTSISQHTFFDLE
ALRKLHLDDNKIDKIERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLEILDMAFNQL
PNFNFDYFDQVGTLSNLNVNVSHNQIRQLMYNSSWSGRNEHGGMYHSNIKILDLSHNNIS
IIHPGYFRPAEISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSYNWIHELDFDAFKNTK
QLQLVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRGLPDNLFYNGGMEKLDVSHNMML
KIPSSSLSSLAALTLCELHLSNNFISTIHSMDLSNKFRSLRYLDISYNYLLRIDDAVFAT
MPKLAVLDLSHNRDLKVMDKSFMGLENSLIKLGLENISLSTVPEIRLKYLREFRLGYNEL
PSIPQELAHNMSNLRMLDLSNNDLTNVPLMTQALPHLRRLMLSGNPITSLNNNSFDGVNE
DLEMLDISNFRLHYFEYGCLDSLPHLRSLKLTAYSHLEHFNIPHLLRHHYNIRQLWIEAP
QPFTRIVKKGSGPTQEMQTLQLGNPTDLQREMEGHLPSKLTNITFSGPQFTNLNERILRG
MRSPYLYMQLFNTSLQALPPNFFKYMGRVRNISLDIRYHNRNLKKIPNPNTGAVPYLPNS
VFLTDLKMSHTDLNCDCDLGWVEFWQRKRRQYICSSQTWTDTVFRTFMNSPCQVYGRHNC
DEHDDDLRETRCENKGGQQLMEALKFDLECGWDNANCREAAFVVVMVCVAMVFWM
Download sequence
Identical sequences F0JAG8 P12024
NP_524605.1.81976 FBpp0085139 FBpp0303132 7227.FBpp0085139 FBpp0085139 FBpp0085139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]