SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085140 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085140
Domain Number 1 Region: 444-511
Classification Level Classification E-value
Superfamily E set domains 0.0000000000199
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 1118-1169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000118
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085140   Gene: FBgn0051004   Transcript: FBtr0085779
Sequence length 1431
Comment pep:known chromosome:BDGP5:3R:27005305:27021484:-1 gene:FBgn0051004 transcript:FBtr0085779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFKLFVVCALACGFMAFVLANENISTEEFEDQIINAVPEPVKVTKPKAQAEFVEVPKAT
PAPKKAEADNPKTKPLALQKPTLIPVVHVSSRGTDDILTVAGLKPEKMFGALIMPNDYLG
ELYDVDNSGYNWDPNNNVAPPTTYSTAAGGYTITAARLAELRSNFMYWYFDKDMYGGRGD
YQFDIHASMTQLHKNLNFQLPFYGFRFNYTRLSLNGYLEFSDPPEYLTYPLVFPIKDWPA
KRDPSFMGIFFSKCRVGRIYPSDIDQRTPGVYFRVERDLMGRTDRFGVEVRERTMWDIRQ
GVVGADTFIPKHVVIATWKNVSFAGGIDNSLYTTNTFQMVLATDEVYTYIIFNYAVLNWL
SHTEAGGDTTKGEGGVPAYVGFNAGNGTQAYEYNPYSQNMVIRDLANRGWANGFPGRHIF
RVDEQILIGSCNKDIDAALLPLTFAPESGNMLGGQVVNITGPCFDPAIRVTCHFDTESVL
GTYVDRNRVICVQPYLKAEGYIRFQISVGTQRFKWRGKYFVETPAAATEKIFFTTDDVHK
KNPAEIRITWNQYNLTSNANANVMISLWGYRETKIEPQLEYIDVIEASYSNSGSYVITPS
NYINRNNINRDMQFGFLQINLTQPDQYSGLAISPVLWSRPIPLAWYMAPQWERQHGKRWA
RALCDNWIRADRFLRNFAADLPLCPCTLDQAVLDKGRFRPDRECDKDSNPSCLRHRGAIH
CVVSGTPVAQGAEQQCCYDRYGFLMLTYDQMWGSRPRRVHNLGKMPWNEASKVPSLSMWF
HDMRPFYSCCYWQEEQAVGCETYRFERRPSQDCVAYQAPGIAGVFGDPHFVTFDGTAYTF
NGLGEFVLARSVDESNKFEVQGRFEQLPVNYYGEVKATQLTAVAMRGNTTTTIEVRLRPL
HARWRYRLDVLADGRRVYFDRESLKFQHFDGVTVYTPTYLLNQSQVVVQFDAGIGVEVVE
NEGYMTGRVFLPWKFINKTAGLFGNWSFNKLDDFMLPNGQVAQLNLNDLRSIHTNFGIKW
MLTDREVPGVGAALFKREFGRMSGYYANATFQPNYVLDPADFLPANRSYDLERAEELCGE
CMQCQYDYAMTLNRDLAHFTKNYYDTIVNMQAENAVRVVSCGVLQTPRFGRKLSFDFMPG
AKVSFECNEGFILIGDQRRECLSNGLWNIPEYGYTECLREVYYTRRVAFIAIGIIFLVIC
PLMLCIVCGVYRYRQKQLKEDPQWQMPMLPRSRASSARNLRTLNYDDDSDTDASTLKKTK
KWDLDENDEDVTSSEGEKPKQLGRRSLHSASGTELDQHGSPVDGDHPDEDDDFDEADVHT
GTTHPVGYHQPLSPEEADQLHRQQYSPTFSGLDSRTSGASSINYTPQAATQNRFGGVPVL
PSNTQYYSRPPSSVNTVPLRTAPTPLTQDTGLPSPPLATSPTPSVQKSTEV
Download sequence
Identical sequences FBpp0085140 FBpp0085141 NP_733418.1.81976 NP_733419.1.81976 FBpp0085140 FBpp0085141 7227.FBpp0085140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]