SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085182 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085182
Domain Number 1 Region: 45-277
Classification Level Classification E-value
Superfamily L domain-like 3.69e-37
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 273-369
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000118
Family I set domains 0.011
Further Details:      
 
Weak hits

Sequence:  FBpp0085182
Domain Number - Region: 639-746
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00209
Family beta-sandwich domain of Sec23/24 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085182   Gene: FBgn0039862   Transcript: FBtr0085821
Sequence length 836
Comment pep:known chromosome:BDGP5:3R:27447858:27490368:1 gene:FBgn0039862 transcript:FBtr0085821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSMDRRRSRTPRTLPVCWILLCLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQL
TTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKI
LVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLIS
YIDPMSLANLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWY
VNSRLSSVSLVCKGPPAQKDRTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLV
YGDPLPEVAWELNGKILDNDNVLFESESIASDKLWSNLTVFNVTSLDAGTYACTGSNSIG
SMTQNISIYLSEIVQHVLEKTPETFWYFGLIMGIFGTVFLLISISFVVCLCKRTTRQHRH
ANKAGVKSSVSFNDQEKKLLDSSVTTTTNDRGDSYGIDNQPTSIGMNKGDSAGMGFNQIE
IHAVESHRHGSMLVQQQPQQQQVAGGGGMRQQLMQVKDSTCGMMSVPTSMAGHAHSHPAQ
ISEEFPLNVGVFPPPPEFCSNIVPNPAFGGNIFIRVSVTQDMLDGADLNMYPDLLNIPKR
MQDVQESGAGAVAVPEGQFATLPRHTARRGILKKDTSLQQQQQQHQQQHQHQQQQQQQQI
QQQQHQQLQQQHQPSGLYTHDEIVTYNLEASGYDPHQSGYHSNAMELPPPPPPPAVTAVV
QCHHPSPNNCASCINNAPPPPSACQSPPVEVTPMRPLDSSAYPKYDNMGRRITASGGLGG
SNLSLHDEERYENETLFGQAESQTKGMPEQSQDLHQPQEVTQGQDKGGGPGEFVSL
Download sequence
Identical sequences Q9V9V6
FBpp0085182 FBpp0085182 NP_651880.1.81976 7227.FBpp0085182 FBpp0085182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]