SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085185 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085185
Domain Number 1 Region: 518-614
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.14e-17
Family PWWP domain 0.0027
Further Details:      
 
Domain Number 2 Region: 393-514
Classification Level Classification E-value
Superfamily Bromodomain 0.000000000072
Family Bromodomain 0.0018
Further Details:      
 
Domain Number 3 Region: 337-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000576
Family PHD domain 0.011
Further Details:      
 
Domain Number 4 Region: 1393-1435
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000192
Family MYND zinc finger 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085185   Gene: FBgn0039863   Transcript: FBtr0085824
Sequence length 1664
Comment pep:known chromosome:BDGP5:3R:27495187:27503693:1 gene:FBgn0039863 transcript:FBtr0085824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTDSSDSSGDSLKSIPRPDFEALSAIGSPQPQLQSSSLDGHVEMEPVIMPSKRQKYIV
SAPPGSANCSSNSSSSSPSNINVGSSLTMKLTKVQPQQHQAKSSTPNNKGKVAKEMVALQ
RSHIESEVLSNFVTGVSKLKSRKSRYVPGNLATQAVGGELSRSLNTSSENENKSLKVALK
RSSSIPAPILDSDDDWQDEDIAWGVTTCRPRGRSMAFEDGERLANLNAEDRNIVPAYSMA
TRCRSRSKTLSLSNSWSNDDKGPRRSNLRSENEEFAKKHNAFLDRIIHDDRESELALNTS
GEGESSLFSDASDTKTTTAKTPEEEAAERLALIYEEPPTPGWDPFCWKCRGCGKLMPCSK
CLRSFHSYCVRPATTKFDSSWKCPECQVIEAAPKRLRRNGVSVDLLSQLLSFALDRMKHV
RGAHKLRSPLEVFPLTYKKFFVNPVSFESLAQCIRNGAYQSTDEFLSEVKWIQHNALILD
AGDAKVEQASKAVVKVCRQEANEIDTCPECYLNANSSDEWFVKVCRHPHLLLWAKLKGFP
YWPAKAMGSSNSTLVNVRFFGKHDRAFVPVKDCFLYSAQNPNTQTSRRSARDLAECIREV
EIHIDHIKRKIGAFNYAPYRTPYDPLEEQQQLEQMMPGVYAAIDRELEPANKTPLQFLIR
KTADDKLSIVKKTKATESGNESDQSPSPTKKLSEVDVVSVTGSGCSDHSNVKSNNYEVIS
RSGESLTDSRCKVLLKRKSLAAKIVAESVETSEAVAPKRKHSLSDASFTSESSEHKRKSK
HARKQHDNQDNQIEEAEKTGQEPPKSPTISKQNENLRDEENVIENAANDTSSASPVSASV
VSVVELVRRRQGVTITKIPREQQQTAEDTAAVPIPLPTAPPPKQNIPKGNEAANPKQSDV
ERQQEQLIKKVIPFIEIKTEVMSEPDDEGIEEASPANQPQTDQVPLQQETITAQPESQMP
AAAPAPQPKPVDNAPFEEVRIKEEILSEDEMETEQSIVSRRLKSVPPMPLPMPPPPPLPP
REESPATADSVRFVGDTTIQRVSQKQGGKSTDTGGKRKGVQQVPIAGIPQAPSPTHSPLL
STAPSPSASPKPTSTLAVSKPPPPPPPKGKSASHLQFRGKNDRIPTSPPATAPPATNTSS
LLRSNMVVIPVEQGGSCNAHSPMTIPVPPLRAVSKNTLQNTSTGSTSSCVPSSVSMPPPL
AGLSIPPVATPTSQEESITNSGQPVGLLASALNGTANDVLSSDSIPNDPITPGLATALSE
MLLHTGVPKLIARPRGALRSDGSQIYPSQAGPVSQKLKENAHKITDYFISVIEDTLSDMA
TGDQSVLQARIAGLSLENERLKQHYDRQINDLHRTSELMISEMRKTLEQEHKRVISELRQ
QNAIELMRAVEEAKRKQWCANCMREAQLYCCWNTSYCDYPCQQLHWPGHSATCGQSVPPT
IPVPPSVPTPIIEPGRAKAKVATPTATPSITNPSPSSQIMRTVAACPSAPPSANASSSKK
WPPMMTLMNQSNQEAMLKLPATTYLRPVVSTTMTAPVTAPQPANNNSTNVIMAPTPPPGN
NLATIISAQRNPPNYNAKHPNPAMPVQRFNIPLPITVNSNAPFMMAEQHQKQVPKATGRS
GKNNSRMRQTYSNNINNSNPQGMRCNNNPQAIRQNQMNQQVFQP
Download sequence
Identical sequences Q7KRS9
FBpp0085185 FBpp0085185 NP_651881.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]