SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085327 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085327
Domain Number 1 Region: 12-148
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.53e-33
Family Cap-Gly domain 0.00081
Further Details:      
 
Domain Number 2 Region: 132-347
Classification Level Classification E-value
Superfamily L domain-like 2.41e-19
Family Internalin LRR domain 0.024
Further Details:      
 
Domain Number 3 Region: 438-522
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.98e-16
Family Ubiquitin-related 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085327   Gene: FBgn0033055   Transcript: FBtr0085974
Sequence length 523
Comment pep:known chromosome:BDGP5:2R:1930160:1932469:1 gene:FBgn0033055 transcript:FBtr0085974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGIIDEVQLFYPLGTRIKIGDNYGTVRYVGEVSGHMGSWLGIEWDDGLRGKHNGIVDGK
RYFQTQTPTGGSFIRPGKVGPCATLEDAARERYLNYDSSNVDESLIREAQASLQASLFEV
VGMDKIARKQSKFEQLEEVSVDQTPVNAAGYLKELTHLTTLNVSHTLIWNWEIVASIAQQ
LPSLTNLNLSSNRLVLPTSSQITELEPSFRQLKRINLRSCGFSDWKDVMHTALLWPNILS
LGLQENSLGQLAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEE
IKLPDCDSQEKLNIFVSLEQLNLLHNPIWNEADAFNELDKLPQLKRLSKTPHLKSNFDEM
FSKAVASIASLQFINKAEVTAEQRRGAEYDIWKKYALDWMQATQGGTDSLREFCRRHRTY
PLLVKKYGSPADFVPRSQAKQSNLINVSIRHQLTGETWEKKVPRMITVQTLQGLVMKRFR
LSGDVPQLCYVDALHPDLVVPLDNNAKTLDFYSVQEHDTVLVQ
Download sequence
Identical sequences A1Z6J5
FBpp0085327 FBpp0085327 NP_610197.2.81976 NP_995747.1.81976 FBpp0085327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]