SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085344 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085344
Domain Number 1 Region: 408-486,535-633,720-851
Classification Level Classification E-value
Superfamily TPR-like 3.98e-26
Family Tetratricopeptide repeat (TPR) 0.0074
Further Details:      
 
Weak hits

Sequence:  FBpp0085344
Domain Number - Region: 86-185
Classification Level Classification E-value
Superfamily TPR-like 0.00949
Family Tetratricopeptide repeat (TPR) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085344   Gene: FBgn0021847   Transcript: FBtr0086000
Sequence length 861
Comment pep:known chromosome:BDGP5:2R:2097287:2101623:-1 gene:FBgn0021847 transcript:FBtr0086000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKNMRNTTTKVEALIESCRSEGKWHRVIELTDELKTGSPHNECLANFLVGEARLESYL
EENALASDSNFGRAKSGLAEARRFLHLALGESGQKAGIALDAYLLLAKLCFACGEYEQSL
DNFVKAELNTLAEKELTLRSLKILAESYAIKGLCLEQQTTKPSSKFKKAEKDTEMISCFE
RASDLGLLYLQEYDLVSGSSGSSNNSTAGSTLNVNASTVQPSSSSFAISSTIPASGPSGL
EMNRRMGAILETALQRAPIVLIKTEKLQEAVERYRIMLNAIETRATQSLRLTLARQLAEV
LLRGVSGTIYSPPFTGKSGGGTLRGGSSKKLWKPRKYAARQQFNPRNQQEEVILLLLIAE
ALAVRDTVLSQSPEFRQARQHAMGNVTAVYDLLTLATVRWGLVQLLNESFEKALKFSFGE
QHVWRQYGLSLMAAEKHSHALRVLQESMKLTPSDPLPCLLASRLCYESLETVKQGLDYAQ
QALKREVKGLRPSRSQLFVGIGHQQLAIQSNLKSERDACHKLALDALERAVQFDGNDHLA
EYYLSLQYALLGQLAEALVHIRFALALRMEHAPCLHLFALLLTSSRRPREALGVVEDALH
EFPDNLQLLHVKAHLQLHLEDAETALGTVQHMLAVWRDVYEAQLAGEEEKHSDTKSGVHL
AHSSQMSDKDSNSVYAASLAAVSRVEQALSEAASSLSSFTQRPGPRRPWMLQIEIWLLLA
DVYLRIDQPNEALNCIHEASQIYPLSHQIMFMRGQVHVYLEQWFDAKQCFLNAVAANPNH
TEALRALGEAHLVLGEPRLAEKMLKDAAKLDPSCPKIWFALGKVMEILGDFHASADCFAT
SLQLEPSCPVLPFTSIPLVFE
Download sequence
Identical sequences Q7KN74
FR725 FBpp0085344 7227.FBpp0085344 FBpp0085344 FBpp0085344 NP_652063.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]