SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085409 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085409
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily TPR-like 3.54e-23
Family Tetratricopeptide repeat (TPR) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085409   Gene: FBgn0039969   Transcript: FBtr0086073
Sequence length 98
Comment pep:known chromosome:BDGP5:2R:1491092:1492333:-1 gene:FBgn0039969 transcript:FBtr0086073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILEELARTHPDGRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIESNDQVRSLEEYIKKE
IDKEVAKGMVVAGGAALVLGGILGLGIAMARNKQKREK
Download sequence
Identical sequences A0A0J9R7G1
NP_001286140.1.81976 NP_652100.1.81976 XP_016026031.1.80810 FBpp0085409 FBpp0085409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]