SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085553 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085553
Domain Number 1 Region: 161-217
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000918
Family Variant RING domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085553   Gene: FBgn0034546   Transcript: FBtr0086240
Sequence length 425
Comment pep:known chromosome:BDGP5:2R:16615329:16618115:-1 gene:FBgn0034546 transcript:FBtr0086240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECEKCDITSNAGDHRLNLTRSLSDLKPETTLEMEIDEALSSSSADDTPPGMIVVETRIS
SWQKVKCYDKDGTTADAEDPQIPACSLGLKPNVQFQKLPHPSHPLVSTEAVLAAATSSSY
SAGPPKAAATDSIATLRHCVDGATQCNNLNYESASNESMPSVGSLVCRICHNADNPEQLV
SPCLCKGSLTYVHVHCLECWISTSRCTTCELCQFQYNTEQTLRYTCLQSLRLWYSRAMSR
RALQEDCQMFSLLTLVAFGIIGTLLVGIQYYALHTHSWGLSKLWTKSWMLFFLFMTITVY
FANIYMLIKSQLTPWYRWWQSARDIKLILENRRPFPNPSRFLRSFQLETVSTTASMYTHH
DQQEAPVPSSSPVIVITSSEEETEDKLAHKWGTRLDSEVLAAVVAATVESIADASARESD
KQDED
Download sequence
Identical sequences A1ZBY4
7227.FBpp0085553 FBpp0085553 FBpp0085553 NP_611511.3.81976 FBpp0085553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]