SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085559 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085559
Domain Number 1 Region: 34-242
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.04e-45
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 484-594
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000464
Family Ankyrin repeat 0.0043
Further Details:      
 
Weak hits

Sequence:  FBpp0085559
Domain Number - Region: 272-291,337-383
Classification Level Classification E-value
Superfamily TPR-like 0.0114
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085559   Gene: FBgn0034542   Transcript: FBtr0086246
Sequence length 650
Comment pep:known chromosome:BDGP5:2R:16549979:16553143:-1 gene:FBgn0034542 transcript:FBtr0086246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAELYRTRKRWYESAWPGAGFWRGANDTLPVTNYITYPANFDQPDGQSLTPLTMAAMMG
NVKFVKTLLSHYDVDLDRECNVIYDGMVVYGATALWVAAGMGHLQIVKMLVQAGAAINHN
TKAQSSPLRAACYEGRLDIVEFLIDNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNG
SRANDQALCGATALHYAAESGHLDVVVALLDHGATLKKNELGITPALQAAERLHEDVLEA
FIERPELMSLEEQITALELLGATYANDKIKYDVNKAYGYLLRAMQLRYSNPRGVIRKRVQ
PTVPAYDNWLETENLPELYAIKLNHHSIHMESLAIRERILGRNNPELPQAIIYRGAVMAD
QGRFYQCQVLWNYAIDLRMRNNVSVDRDLLRFAQLFAQILRVENHNLTLDHVLPVLAKCQ
QEIENNKFKIKEAKPNACPSLWQDQNNQNCITALYLIKIVTHLARRKKDQNIDEEHIQQL
FLVVRKFIQNDTRLQDGQTLLHIAVNGVMPVDEFYTNEMCRFPCYATALVLVHCGASVVA
VDSDRNTPLHILVTKVNTTQDRQAEMARILELFVEAGAHLDAVNAAGQTAATACKLPILA
NRLHAHQNAHTSLKCLAARSIATNRLNFKGLIPTQLEAFIQMHSVRKVLP
Download sequence
Identical sequences A1ZBY1
FBpp0085559 FBpp0085559 FR818 NP_725993.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]