SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085620 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085620
Domain Number 1 Region: 215-606
Classification Level Classification E-value
Superfamily RNI-like 1.96e-54
Family 28-residue LRR 0.075
Further Details:      
 
Domain Number 2 Region: 792-954
Classification Level Classification E-value
Superfamily L domain-like 7.37e-29
Family Ngr ectodomain-like 0.0084
Further Details:      
 
Domain Number 3 Region: 1042-1181
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.2e-21
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 567-696
Classification Level Classification E-value
Superfamily L domain-like 1.98e-17
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 5 Region: 86-184
Classification Level Classification E-value
Superfamily L domain-like 3.15e-17
Family Ngr ectodomain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085620   Gene: FBgn0004364   Transcript: FBtr0086309
Sequence length 1385
Comment pep:known chromosome:BDGP5:2R:15999016:16004437:1 gene:FBgn0004364 transcript:FBtr0086309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATSSIITIIAVAACLLLLVADAHAQQQCNWQYGLTTMDIRCSVRALESGTGTPLDLQV
AEAAGRLDLQCSQELLHASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKRLT
LESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNR
IRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTL
SLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPK
GLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQ
ILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIV
ESQAFRNCSDLKELDLSSNQLTEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTG
LRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLDKNFLTDIN
GIFATLASLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVTTLD
ASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNAL
RVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIECLMPHSRSA
PLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHDATWATNIVDCGR
QDLAALPNRIPQDVSDLYLDGNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQLV
NLRVLHLENNKLTALEGTEFRSLGLLRELYLHNNMLTHISNATFEPLVSLEVLRLDNNRL
SSLPHLQYRHSLQGLTLGRNAWSCRCQQLRELAQFVSDNAMVVRDAHDIYCLDAGIKREL
ELIGNLANGPDCSDLLDASASNISSSQDLAGGYRLPLLAAVLVLIFLVVVLIIVFVFRES
VRMWLFAHYGVRVCEPRFEDAGKLYDAIILHSEKDYEFVCRNIAAELEHGRPPFRLCIQQ
RDLPPQASHLQLVEGARASRKIILVLTRNLLATEWNRIEFRNAFHESLRGLAQKLVIIEE
TSVSAEAEDVAELSPYLKSVPSNRLLTCDRYFWEKLRYAIPIELSPRGNNYTLDHHERFK
QPVSPGMIFRQAPPPPAYYCTEEMEANYSSATTATPSPRPTRPGGAARIVDSMPMPMRPP
SEHIYHSIESEYSAYDQHEALSMIPTGLMHQHQQQQLRLHQQQQQQQQQRLLQPQFRAMP
QQAIPAPSAPVHLRSGSGLSQASTSTQSTAQASTSAAAAQQQQQQQQQQAAGSEAANKNG
QAFLV
Download sequence
Identical sequences A1ZBR2
FBpp0085620 FBpp0085620 7227.FBpp0085620 FBpp0085620 NP_476814.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]