SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085841 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085841
Domain Number 1 Region: 330-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.83e-16
Family SPRY domain 0.011
Further Details:      
 
Domain Number 2 Region: 703-883
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000159
Family Nucleotide and nucleoside kinases 0.03
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SAP domain 0.00000000183
Family SAP domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085841   Gene: FBgn0050122   Transcript: FBtr0086660
Sequence length 1271
Comment pep:known chromosome:BDGP5:2R:14519833:14526773:-1 gene:FBgn0050122 transcript:FBtr0086660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVAKLEKMKVVDLRNELQSRGLDTKGVKAVLVERLRAYVEGGAGDGENAPVTPSRRQRR
TRSMSRSPSPVQAAPVAAEPVLDTLEEEEQPEDKTVPQPEPESEQPAAEPEPEQSEPEEA
EPAAAVTEDTTVNQAVNEESQPEPEEFDEKSETDDKQETIEEAVPAVVPQNEVADEPMEE
DHDAAPEEQEPTQTEEPVEEKPAESTVAEHQSNGDSQKMDVDEEDSAAPKTAEETEPAAK
PEDQPPERRKRSHSRSKSRSRSGSRSSKHRGSVGDKRESKAAAEERTVPEDEPTIEENKV
GLSWLDSDLHLRIDPTTFASAKPLTSEIYSLIWSGARANYGVREGKVCFEVRLSEESVPE
NSHYFRDEPHVRGFRVGFSMPKSSLLLGEAEHSFGYCETGRKATQSEFTDYGKPYQLDDV
IGCYLDLESEPCTINYTLNGEDLGVAFEFEKSILGEEGALFPHIVTKGYEYLVNFSDTEQ
LLVNAERPTRKRRKPRKDEDKDKDDDKDDNDGEKWKVLDEATADDDEVEKKDEDGKASSE
KDEEEAEDPEKAKEDEAAPKTETEAETKVEAPAEAAKPESEATEASETAETSTEKSSETA
AVSNGDAAAEQANDEKASEDKKPSENNDEEDEDGPSPNKRPKTDGDSEKAESEKEKDRSQ
TTEDEYEDVVPEPRDTAALLEGYVLIGLVPVEKLVSGPQRVGSRKECEVILLVGLPGAGK
THWAHKHVAENADKRYELIGPDAFISKMTIDGASRKTVHKGRWDKVYEICLNSLAALEDI
AMKRRRNFILDQTNVYASAQRRKMKGFNDFKRIAVVCIPSEDELKRRIAEKEEKGNAFTV
KESTINNLRANFTLPSLEFGWFDDINYTELTGDEAKSEVKKYNEKGKKAIDAERSRDKRS
RGSRDNYRRDDRNRNRYNDDRRRDYGGQRHESRWSDSRRGGGGGGYSSNSGGGGSRGYDN
RRNYNSGSGGQQNWVQNSRRSGYDDRGYGGGGSGSRGYDNRNRGYAGGSGGGGGGGGGGG
GGGGQQNWMQNNRRSGYDDRGYGSSRDYRDRDRGNDRSRMGSNDRNRGSSQSSYRSGGGT
HQQRDFRPGHRDTKEDSRGGYERSAGQSLPKYGNNTAVGGGYDQYKQQGGAPGGGKASLS
GKWSTYSQHHQQQQAPQHQQTGIWQTQQQSQQYQQPQQAAAGQQQYWAYNQMQSYGNQQA
WQSADPQQQQQWMSWWQQQQQGSGGAAAGNASGGSGVNVGGGAGNNDGGAANHYWSQYSY
STQSNAGADKK
Download sequence
Identical sequences A1ZBB4
FBpp0085841 FBpp0085841 NP_611354.2.81976 7227.FBpp0085841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]