SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085902 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085902
Domain Number 1 Region: 224-502
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.97e-63
Family WD40-repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000124
Family U-box 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085902   Gene: FBgn0261119   Transcript: FBtr0086723
Sequence length 505
Comment pep:known chromosome:BDGP5:2R:14334860:14338545:-1 gene:FBgn0261119 transcript:FBtr0086723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVCALTNEVPETPVVSPHSGAVFEKRVIEKYLLENGCDPISGKELKPEELIEIKTPAV
VKPKPPSATSIPATLKTMQDEWDALMIHSFTQRQQLQTTRQELSHALYQHDAACRVIARL
NKEVAAAREALATLKPQAGIANAPTAIPQPALASEAGGAAAHPMEQAGMSAEVIQKLQDK
ATVLTQERKKRGRTVPEDLVTTDQVKNFLTVASHPGLHSASVPGILALDINSADHSKILT
GGNDKNATVFNKDTEQMVAILKGHTKKITKVIYHPNEDTVITGSPDMNIRIWHVPTSQTQ
LLLRCHEGPVTGLSLHPTGDYLLSTSSDKHWAFSDIRTGRLLTKVIDTAEVGLTTAQFHP
DGLIFGTGTVDSQVKIWDLKEQSNVANFPGHTGPISAISFSENGYYLATAADDACVKLWD
LRKLKNFKTIQLDDGYEVKDLCFDQSGTYLAIAGSDVRVYLCKQWQELKVFNDHTALATG
VRFGKHAQYLASTSMDRTLKLYAIE
Download sequence
Identical sequences Q7KLW9
FBpp0085902 7302603___KOG0289 NP_523783.1.81976 FBpp0085902 FBpp0085902 7227.FBpp0085902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]