SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085991 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0085991
Domain Number - Region: 49-122
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0167
Family BAR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085991   Gene: FBgn0034291   Transcript: FBtr0086812
Sequence length 213
Comment pep:known chromosome:BDGP5:2R:13931551:13932565:-1 gene:FBgn0034291 transcript:FBtr0086812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNILCTVLIFASVLAANAKPNNQIQSALDQYLVHARSLDTFVSEDMTTQCFNLYMPMLNQ
VAATFSSSYQDCITTANAQIANLTAQAEQQQKTYQSDVSTLCSAFTACDSNNDTANFFNC
YANAADNDVSVIYNLASNAASSATSFSSGIQAIQDTEYQCTNTTQNNYVRDTAATYDLLD
NCLKNGVPTTTATSSSAAPQTTSTTDGGFLFGL
Download sequence
Identical sequences Q7JYK5
FBpp0085991 NP_611282.1.81976 FBpp0085991 FBpp0085991 7227.FBpp0085991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]