SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086001 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086001
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily L domain-like 4.08e-29
Family Internalin LRR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086001   Gene: FBgn0034282   Transcript: FBtr0086822
Sequence length 261
Comment pep:known chromosome:BDGP5:2R:13753827:13759515:-1 gene:FBgn0034282 transcript:FBtr0086822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKRIELERRARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLP
NLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDA
TQVDNYREKIFKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGNDSDEVGVSDEDDDSDDS
DEEANGEVSLSEVYNDDLEEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVNAKD
KDGEKEADESQVRGKKRKHDG
Download sequence
Identical sequences B7YZR7 Q9V895
FBpp0086001 FBpp0086002 NP_523780.1.81976 NP_725732.1.81976 FBpp0086001 FBpp0086002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]