SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086007 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086007
Domain Number 1 Region: 116-198
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-18
Family SH3-domain 0.00059
Further Details:      
 
Domain Number 2 Region: 423-496
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-17
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 3 Region: 770-836
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000129
Family SH3-domain 0.002
Further Details:      
 
Domain Number 4 Region: 194-255
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000486
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 5 Region: 5-72
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000574
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086007   Gene: FBgn0040294   Transcript: FBtr0086828
Sequence length 838
Comment pep:known chromosome:BDGP5:2R:13456232:13459827:1 gene:FBgn0040294 transcript:FBtr0086828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEHTLNDLLECSVCLERLDTTSKVLPCQHTFCRKCLQDIVASQHKLRCPECRILVSCKI
DELPPNVLLMRILEGMKQNAAAGKGEEKGEETETQPERAKPQPPAESVAPPDNQLLQLQS
HQQSHQPARHKQRRFLLPHAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQ
EGTFPINYVKVSVPLPMPQCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRI
GQTIGIFPIAFVELNAAAKKLLDSGLHTHPFCHPPKQQGQRALPPVPVIDPTVVTESSSG
SSNSTPGSSNSSSTSSSNNCSPNHQISLPNTPQHVVASGSASVRFRDKGAKEKRHSLNAL
LGGGAPLSLLQTNRHSAEILSLPHELSRLEVSSSTALKPTSAPQTSRVLKTTVQQQMQPN
LPWGYLALFPYKPRQTDELELKKGCVYIVTERCVDGWFKGKNWLDITGVFPGNYLTPLRA
RDQQQLMHQWKYVPQNADAQMAQVQQHPVAPDVRLNNMLSMQPPDLPPRQQQATATTTSC
SVWSKPVEALFSRKSEPKPETATASTTSSSSSGAVGLMRRLTHMKTRSKSPGASLQQVPK
EAISTNVEFTTNPSAKLHPVHVRSGSCPSQLQHSQPLNETPAAKTAAQQQQFLPKQLPSA
STNSVSYGSQRVKGSKERPHLICARQSLDAATFRSMYNNAASPPPPTTSVAPAVYAGGQQ
QVIPGGGAQSQLHANMIIAPSHRKSHSLDASHVLSPSSNMITEAAIKASATTKSPYCTRE
SRFRCIVPYPPNSDIELELHLGDIIYVQRKQKNGWYKGTHARTHKTGLFPASFVEPDC
Download sequence
Identical sequences Q7K4D1
FBpp0086007 FBpp0086007 FBpp0086007 7227.FBpp0086007 NP_523776.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]