SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086049 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086049
Domain Number 1 Region: 119-239
Classification Level Classification E-value
Superfamily L domain-like 3.85e-18
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 2 Region: 287-427
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000017
Family Ngr ectodomain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086049   Gene: FBgn0034262   Transcript: FBtr0086889
Sequence length 499
Comment pep:known chromosome:BDGP5:2R:13577779:13582856:-1 gene:FBgn0034262 transcript:FBtr0086889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGVFQKRPKAAETISLFCMILIRLSRAADDSHETSTLLATITTITTEIIPMPDSGRSC
FGWSSAPEAAGGNCSRSNRNGTLKCYGGMNNLAALNQSGKLSRVQPALEMLLCGWPKDGL
NHFRDLQKLPRLRSLTIEYSGFTEFKFDFPEMLELHTINISWTNLSYISSRTFKRVHPLK
VLDLRWNQLIQLDGPLLLPRNFEQLYLAGNPWNCTRNFKWLLLQPEKGRLVVDRDELICT
DRKYKERQMLMVMHYKLELKRQCQSHEDLRNCTCLMHHILPKTHIPLYTVNCSHLQFHRL
PDFLPDNTTTLVINDNMISDINPLRDNPHYRHVVDMQLENNQISNVDNLEDTYWLQNFRL
LNLRGNNLRKLHVYALDNALDDNENANLLLLSRNPWHCTCKFGSRMRELLTKYKDIVRDA
WNVSCTYRLDDDQLLAKVLTLSRQEMCNLSVEGGTQIHPIDWLNGVLASLIFLILGKLAY
DYYYYKYYGRVPWIVMKMP
Download sequence
Identical sequences Q8SXT3
FBpp0086049 FBpp0086049 FBpp0086049 NP_611247.3.81976 7227.FBpp0086049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]