SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086117 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086117
Domain Number 1 Region: 632-814
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-26
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Domain Number 2 Region: 183-290
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-18
Family PDZ domain 0.046
Further Details:      
 
Domain Number 3 Region: 5-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000346
Family SAM (sterile alpha motif) domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086117   Gene: FBgn0021818   Transcript: FBtr0086962
Sequence length 1557
Comment pep:known chromosome:BDGP5:2R:13301476:13307104:-1 gene:FBgn0021818 transcript:FBtr0086962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYINIAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGH
QEIVLEAVENLRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAESTKIDTRILHDIT
RTIATLKPLVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAE
RLENLANFVIQDISDPMVLQPASLNLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAH
NSGKIEDGDEIVQINYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPY
RLPSKKRNMAARWAAQMPSPRAAFLTLDTEQLATGGTGSAVPDPSKSLSSEKREVLTKAN
PVSSASDSDSSCSDIPTPTDPKLAAREIRLYYPKPRALLQRRNTICGCEYLSLKNSDLVV
PSWHERKPGIGSPTNCDPGSPSIRDKSISFGYGLEMAARPTTCIGIAGDTSTDKARRMFH
EARKLKQLTEDSQREFLVDRYKPGVSKVVRFDAKEDYVMKNEKFICNVENTILETFEPIP
FADEGDEDALETLRNCKTENAEELLEAINLATKGQDLPLAEAINMPLLQQGRRGRLDKSH
STPAYDNSGEESDTPPAIEPRKEFLLVTPPAPPPRPRKQREMTPPAVPPPPPKPASMQPA
SSITSISIPVPVPVPAAVDPSEISELHTPSKSRTLTLKKKHSLMAKRRNTNLKLLGTGDI
QGHLYRRKKNHRGVTYWARIYFVMLDTILYGFRSKQSTSASLVIFLPGFTVSLAKEVHSK
PHAFKVYHTAKSFYFAAESLDALNQWVDFLRQASLKVPPSTGSKGGGDAKDLYSENDSSG
EECDALVIQNLSTPSPQGNKESMSMSMTLSGGTPPSSAPIKHERGYLDSFRKFTNTFKSS
AAKPSSDIPVPTEQYRSYRKVPGGSFGIQIGANTPGYHDPAMPPTQIPPLVGPKLSRSSS
RSSVVSGTESAVSLSASILGPPASPAPTPTPTATPTSLQHQSSEESPSQSQSQSPSSKSS
LKKAPFNFLHASNPNLVEFDFHTSKTLLPKMSVGNTLDHGHNIQGFVTLKDLMLRKQEEE
AQEMYNNRVHLGVEKHKHARTESTASQQSAMSSSVTKPLEKLPKIQSVSLPKTPDYEISF
KPDDESIKRTRTKEGQKLRDFGYELICGDEPSTSSISRQEHHHHHHHHQHHLQHVQQQQQ
LQHQQTQQQHSSKAKHFLRSQQLQLSSFLHKNSSGGSGKSSGSGADQKKSKGKSSGDRRF
PFSKHSTGSAGSGCGPGHAMTMTLPLNKKSKSNHALDGAVGNGVTIIGSGSSIKKSQTYN
QDLRDKIVGTKYDAHRKNSAPIPIFSKLSISGGTPAKPSKENRFLGSPLLHRTLFGHHHH
QQQAVTPPSSADPDCDQEIFSQITLPTHNQAGYRSYRGPGILTTSTTNLCSSEGLQPPLP
PAPPPPVNTSRQREEEQAEATISECAATPKVSSSGSVDSKAATPDYPNMECPPVFEPEIY
SLSDTSLSRIVMRTPSSSGATSATASTTTTNNNNNNNNTNNNTNTNSSPSGGEHHQT
Download sequence
Identical sequences Q7KNQ9
FBpp0086117 FBpp0086117 7227.FBpp0086117 FBpp0086117 NP_001286524.1.81976 NP_725671.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]