SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086146 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0086146
Domain Number - Region: 18-46
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0104
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086146   Gene: FBgn0261642   Transcript: FBtr0086994
Sequence length 243
Comment pep:known chromosome:BDGP5:2R:13153023:13266881:1 gene:FBgn0261642 transcript:FBtr0086994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYD
SIKGRCNRDKPPCKYFHPPQHLKDQLLINGRNHLALKNALMQQMGIAPGQPVISGQVPAV
ATNPYLTGIPANSYSPYYTTGHLVPALLGPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEM
DVKTVGSFYYDNFQFSGMVPFKRPAAEKSGIPVYQPGATAYQQLMQPYVPVSFTGHPPGV
PRF
Download sequence
Identical sequences FBpp0086146 NP_788390.1.81976 FBpp0086146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]