SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086219 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086219
Domain Number 1 Region: 66-125
Classification Level Classification E-value
Superfamily RING/U-box 0.00000318
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086219   Gene: FBgn0025833   Transcript: FBtr0087071
Sequence length 608
Comment pep:known chromosome:BDGP5:2R:12762229:12783156:-1 gene:FBgn0025833 transcript:FBtr0087071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGRKSPLEALALPGVMLAYKYSQFRQRRREAASRRVTERELSALHHKIDKLLSKLEEE
SEPDPPTSQEDECVICINARATMQTSPCGHRVVCRRCFVKTIQSAVAQRLLPLRCVICRA
RVNRLTSSSGTWRIQESASSYSMGAKSWASAGVAAGGVVPSASSYSMNDAHSGHHSFHQP
TLHKSAVGRHHPHHYAARGSAHARVSQSDSLYSMSSTGSAASSASGYSHYSKTSSISSNG
PCSPASPAVASSSNHLAPPSPTTHHHSHSLASPTPSGSSGSSLSPRENGTSHSHHGGCPI
GCSGAVPRKPLHTLTNSSSTPISGSSSSGSGGGGVGNGNGSVPSGMMTPTHTYPGRRHVK
NRLMDIQNRLPPIKEFRSPAKVPHPSPVHVSNPRFRYSTYTKSSAHELAPLLRESGSSPP
PRRPSPMNIQLSCSALAPPPLKAGGAKICPLTSKNSLPKNAYVMPKDKKQPASVPQGKAT
GTASKSTPQGAGCSRASAGCSAANSGSTGAGSASNPKPSSSSSSRSFPLFSAASNQREKA
DNKKNESVERKKKEEKLKLKAEKEARKEEKRLAKEEERLAKLHAKEEKKRGKKEAKELLL
ANDGNSKK
Download sequence
Identical sequences A1ZAL4
FBpp0086219 NP_611167.2.81976 FBpp0086219 FBpp0086219 7227.FBpp0086219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]