SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086323 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086323
Domain Number 1 Region: 281-447
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.02e-63
Family Cyclophilin (peptidylprolyl isomerase) 0.000000627
Further Details:      
 
Domain Number 2 Region: 41-107
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000274
Family U-box 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086323   Gene: FBgn0034109   Transcript: FBtr0087179
Sequence length 517
Comment pep:known chromosome:BDGP5:2R:12179769:12181631:-1 gene:FBgn0034109 transcript:FBtr0087179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRQHQKDKMYLTYTEWSELYGGKKVESLENDHVKFKRLPFEHCCITMAPYEMPYCDLQ
GNVFEYEAILKFLKTFKVNPITGQKMDSKSLVKLNFHRNANDEYHCPALFKPFSKNSHIV
AVATTGNVYCWEAIDQLNIKTKNWKDLVDDTPFQRKDIITIQDPQKLEKYDISTFYHIKK
NLRVLTEEEQQERKNPASGRIKTMNLETKETLEQLQQDYQPAEEEASTSKRTADKFNAAH
YSTGAVAASFTSTAMVPVSQIEAAIIDDDLVKYERVKKKGYVRLNTNLGPLNLELFCDQT
PRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIWGKKFEDEFKPNLTH
TGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNKDR
PIEDIIIESSQVFVNPFAEAAEQLAKEREEEAAGKEEIVKKEEQQKRMKEPLKVYREGVG
KYLKLQTVAKKPEAPLTSAQAAKKKKLANGFGDFSSW
Download sequence
Identical sequences Q7K231
FBpp0086323 FBpp0086323 7227.FBpp0086323 NP_611113.1.81976 FBpp0086323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]