SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086333 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086333
Domain Number 1 Region: 605-681
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000752
Family Tudor domain 0.0076
Further Details:      
 
Domain Number 2 Region: 358-433
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000677
Family Tudor domain 0.0066
Further Details:      
 
Weak hits

Sequence:  FBpp0086333
Domain Number - Region: 517-543
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00235
Family CCCH zinc finger 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086333   Gene: FBgn0034098   Transcript: FBtr0087189
Sequence length 746
Comment pep:known chromosome:BDGP5:2R:12125608:12128222:-1 gene:FBgn0034098 transcript:FBtr0087189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLEDISMIMKLFDSNMHKLQGNLRSYQTEMHQIHKELTEKLSHADLLYRSLIPLHDHLV
ASLSEVNAHVMKLNVQLHINRQSVRLGDYEYYEKSIDNPYSSIRSGLQAIEKPGCAEAIC
QSSKPAFVECLPSSTSEEVPVVAVQEASSTNQLDAISVVNENLSEERDATPQPLAVSKNM
EETMPSNPFHEQLEGSLEEIPVGSKIVVETEKANNPVRSEASAPATSDNQSLLAAKQGTQ
TIGTGICNKISKSTINMPNNWQLENPTEVTAASIEKVNKLPKSPRNRFLLPPKGGTETTR
RDIYNQILKDMAAFPENTIVTAVLASVDVTDNCAYVAKWDESSDRIKKVLQRQLPLQELD
QLPDYGDIFAVLDSINNIITRITINSSSAGGGYDAYLIDFGEHIHFDGNETIFKLPDDIK
RLPAQAIRCDLINCDIANMHCFVNTYIKIRVHENNNSTLVAEPVIDRLSRPTKTNTTKYP
AGITEDDMAMLNEIDESTSDPLKAVLGFRPKDEQRICRHYDPKLNGCFKGNNCRFAHEPF
APNGATKDVELARALPETIFDTTVHFEIGSIVGILITFINGPTEVYGQFLDGSPPLVWDK
KDVPENKRTFKSKPRLLDIVLALYSDGCFYRAQIIDEFPSEYMIFYVDYGNTEFVPLSCL
APCENVDSFKPHRVFSFHIEGIVRSKNLTHQKTIECIEYLKSKLLNTEMNVHLVQRLPDG
FLIRFLDDWKYIPEQLLQRNYAQVSQ
Download sequence
Identical sequences A1ZAC4
7227.FBpp0086333 FBpp0086333 FBpp0086333 FBpp0086333 NP_611103.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]