SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086514 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086514
Domain Number 1 Region: 970-1064
Classification Level Classification E-value
Superfamily DEATH domain 7.65e-17
Family DEATH domain, DD 0.00041
Further Details:      
 
Domain Number 2 Region: 234-324
Classification Level Classification E-value
Superfamily Immunoglobulin 3.2e-16
Family I set domains 0.038
Further Details:      
 
Domain Number 3 Region: 323-371
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000432
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Domain Number 4 Region: 400-426
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000824
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  FBpp0086514
Domain Number - Region: 128-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00137
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086514   Gene: FBgn0034013   Transcript: FBtr0087382
Sequence length 1072
Comment pep:known chromosome:BDGP5:2R:11237659:11255807:1 gene:FBgn0034013 transcript:FBtr0087382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVINKAGNVIALLLVKLQLILLFTLSVSGELPQLDYGSLSASLEEDAIDPLTAMAPFAN
SLVTEESAQHKNNAELLGNSSEDENVRPQQGSSSSGLGSSGAAGGSGILLEEFNSGKLSP
GEASNTLPIFLIEPESVFVVKNRPAVLKCKASHSLQVIFKCSGSSQPPPSTHETHVDPHT
GVNMEEVTATIHRDLVDEFFGDGPFKCECHAWSSRGVVKSQAATVHIAYIRKSFNQSPTS
LRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITVSAGTLIFRQVALQHMAN
YSCSAENIAGRRVSDSAVLIVYVNGGWSTWSPWRECKCAGKPSQGRKRSRTCNNPMPLNG
GAQCPGPQIQKSADCAACPEDTQIVSPDGFDISSSKRMARWSAWSDWSICSAECIQVRRR
KCLTQGQTQISSEAEEAGDLLLGAPGVGMAALIAAAGVGAVGSPSEATGSSSDIIPGYGK
SLCAGKDIQTAECRGEQCQIGKDDFDWTLYLGLAFITAVCFAFGTALICCARRGIRTNPH
YNMARSVMDADYMPGVVEKKEMRMHIEASNMGYDYVNPGHRYLPGEHIMGMGIGCGGVTE
HHYDVPNLSANYTNPIDHLSVDYLSETGESSTADTSNSTFDMNGKLSILNASKSSTYEML
GSAGGQLRLYGGELLLFVPEHAIGKHVKKHVSLLLLSDECSRVSCATESSILCSSVVHSA
PRNYSFVKPVILKIPHCLVAPEQWHVHIYHADSEHDELSVNWRRAVSVGEETINTPMFVQ
LEATHVFIMTEQLGHFTVVAEPRIQQPSIKMKLLAFSQHTPPSNANCSLRIYVVKDFPNS
RDICANVEAKLGGSFLGESQVFAFTLNSRNLNIRVRSADVEAAAPYEHAIPYQHILSNNS
ILHCEFSLRRQDQNSLCVDFGQGSEDDYYTFNIPAHSMSGSAEELASTTNTTISIDRQGN
YVNESCVMDFVQLPHATKRLICGALDPPRADERDWRLLAKKLNTDRYIAYFATKASPTEQ
ILNLWECRANSSPGSSSNSVSHTIMALLLTLKEMGRQDVLDIIVETIGPLWI
Download sequence
Identical sequences A0A0B4LFH9 Q95TU8
FBpp0086514 NP_001286450.1.81976 NP_611033.2.81976 FBpp0086514 7227.FBpp0086514 FBpp0086514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]