SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086538 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086538
Domain Number 1 Region: 145-408
Classification Level Classification E-value
Superfamily L domain-like 1.56e-50
Family Internalin LRR domain 0.034
Further Details:      
 
Domain Number 2 Region: 20-191
Classification Level Classification E-value
Superfamily L domain-like 6.8e-35
Family Leucine rich effector protein YopM 0.026
Further Details:      
 
Domain Number 3 Region: 760-848
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000892
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086538   Gene: FBgn0033984   Transcript: FBtr0087407
Sequence length 849
Comment pep:known chromosome:BDGP5:2R:10823182:10827807:1 gene:FBgn0033984 transcript:FBtr0087407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLSKCFPCFKFKREEVIDKLDYSNTPLTDFPEVWQHERTLEELYLSTTRLQALPPQLF
YCQGLRVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNS
LQRLPDAITSLISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINL
QRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLP
SELSNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVL
SHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQNIGN
LSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSDNQSQPLVPLQYLDASTKTQLTCFMLP
QVTFKMNSIQAQQQAQEQYEFVYANQQQPHASPSRRICFAEEATILSNAKAQPAPNYPSF
VAAPPTPTPDQMAGSVRLMRSPTPYPKELRQMSKYVRQAQAATSSANASEVREARVVTNG
QIHCDSNNANQDVVDQATTSAIYGIAPETTHIYGVYQQPQQMAHPVPTQEYYGLPLVNYE
AHYQQLYVEANTPLPTTHLNGDQDYELQPLQQQPMQQQALPTPRLEPPPYHIARVYTKKT
PEDLNLYESMRQRKQQQQLQEQTIYQDALNSNSNFKTTAIGAQDVEESVDQLDYQNNISN
NLEPNPEEEDQELDDTMSQHSLNSTATNNTSKASHKKSTWIFGVHKNPTVKQVTLKWENS
IGFDIAELLNQVGIFVSSITPNTNAARLLNLNDKLLEIDGYDLTNANLSDAKRVLLNCGT
VMNIMLSRK
Download sequence
Identical sequences A0A0B4JCT8 Q9V780
FBpp0086538 FBpp0086538 FBpp0292771 7227.FBpp0086538 NP_001188938.1.81976 NP_611007.1.81976 FBpp0086538 FBpp0292771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]