SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086542 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086542
Domain Number 1 Region: 321-387
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.16e-17
Family SAM (sterile alpha motif) domain 0.0051
Further Details:      
 
Domain Number 2 Region: 260-318
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000432
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 
Weak hits

Sequence:  FBpp0086542
Domain Number - Region: 515-582
Classification Level Classification E-value
Superfamily CbiD-like 0.0981
Family CbiD-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086542   Gene: FBgn0033987   Transcript: FBtr0087411
Sequence length 924
Comment pep:known chromosome:BDGP5:2R:10853185:10868089:1 gene:FBgn0033987 transcript:FBtr0087411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSLKPHASTAQAKKVQPPTIPGDSPQDLHLYQQPQQLHHHHHQHPNHHHPHHQPSIPL
YRLSGPLRHHQNHQADDGISMSGSSIVSSPSLEEGGFNLPRETSVALRLKDEVGGTSTAA
PTTGGPGGGGATVVGAPPPGAGKPGVAMVPPPPVFCATLREPLTHKAAVYYHQQLALQED
QGIDLTQSPGRDSPGSSSGSAGSGSRHSTASLDSGRASSYLTGVSSSGASIRAPLSSPRC
SSVSSCSIGSVDRQRNDELIIDWLLEMKHEEYAQLFIAAGYDLPTIARMTPEDLTAIGIK
NPHHRERIKQRIDKLQVLDNLPHFVPGSIEEWLQLLRLEEYIQPLLEQNYKTVRDVTQVT
WEDLEDIGIVKLGHQKKILLAIKRVKDIISGKWNPGGANAYQQQEYQRKPWQFNVPIPST
PSYVPTTRVSWDDTKIYATSSVLNSTAPSGSSCLNSSLANGDAYYCTGSNHECCSGNDVV
LIKVRQPRGKSLESLEDIHDNSTRSHLTFSHYTTTDYGHFGPPTTAAAAAAMAAAATLQQ
QHHHQQLLHQQQQQAAAARLLGNNAPGIGWRRSYDDGDITPTNDATRELLYEQEGGGTLP
RQQRGILQRAVLNTMPPLEHHHYMNAAAAAEYGAASGVEGGANYMGGSPLTGKKIAPEPP
RRHCSIRNSRTLSGEGVPSGAAAQAHQQAAQQQQGQHMFYGHTAQHWQQQQQQAGAGTGQ
QPIYANYATIQQTTAEIHCEKYHDSKSTSSIDSIDTIPFANENTGTIKQRLLNRQELQGG
GAGNNNVPGGGHPAHLHSSSSSSSSSSTNTIANIAHSFHSLKSSSSLHDATLARSESMGS
TASGGSALHLRSPTLDMSNAGGSTAEPASSPEAAVPTVAINNGVPPKVSVNVLNDIGNML
ANLTDELDAMLEEEKRVGLNIDSE
Download sequence
Identical sequences Q7JQG5
FBpp0086540 FBpp0086541 FBpp0086542 FBpp0086540 NP_611009.1.81976 NP_725433.1.81976 NP_725434.1.81976 FBpp0086540 FBpp0086541 FBpp0086542 7227.FBpp0086540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]