SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086545 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086545
Domain Number 1 Region: 444-520,666-735
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 923-1023
Classification Level Classification E-value
Superfamily Fibronectin type III 3.07e-17
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 151-249
Classification Level Classification E-value
Superfamily Immunoglobulin 1.63e-16
Family C1 set domains (antibody constant domain-like) 0.085
Further Details:      
 
Domain Number 4 Region: 248-346
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000027
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 832-935
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000541
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 737-835
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000697
Family I set domains 0.047
Further Details:      
 
Domain Number 7 Region: 40-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000783
Family I set domains 0.084
Further Details:      
 
Domain Number 8 Region: 346-446
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000295
Family V set domains (antibody variable domain-like) 0.063
Further Details:      
 
Domain Number 9 Region: 542-644
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000701
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086545   Gene: FBgn0029082   Transcript: FBtr0087414
Sequence length 1235
Comment pep:known chromosome:BDGP5:2R:10898903:10928901:1 gene:FBgn0029082 transcript:FBtr0087414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFWITLTFAVHLATTICHVMAAVTAPTPAAQVAAPPVQKFHLTPHDLQILEGTDTLLRC
EVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQV
GPAAGNPAIRANAKLSIVAAPSSIVIEGYARNARVEVEERQNLTLHCIAENANPAAEIVW
FQGEVPVSTAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSCEARHKALPPDVPMRAQ
VQLSVLYPPGAPFFEGYSQGETLHRGQEVQIACRSRGGNPPAQLTWYRNGVAISSPQRTS
GRLSENVYKFTAAAEDNGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGANQAKVG
DSVQLSCVTAPSNPQARISWSINGRPLDNSTYKTTSSSDGGWVSSSNISLTIDSQSRTFI
AVCHALNTELTQNVVGSHTVNVLYPPSPPLLTGYNDGDILISGSILKLQCSSAGGNPPPT
LQWYKNDKIINAPSKLVDSKITSELSLLVNASDNNAIYKCKVQNAAIDIPLFATKTLGVH
FPPETVKISVVPKNLVPGIRAKLICDSSSSNPPAKISWWKDGIPVEGLNLANRPGLWGGS
VSTLEMYVNITQDLDGIVYTCQSHNEVLQRSVHETISLDILYPPKFETPQSTTFVGVEGA
PFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGVYICEA
LNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAVLACHIQARPLEAAHVRWSRDGYD
LATRTISSFENGTALLQIASVERSDIGNFTCIVDNQRGAPAAQNVLLVVQTAPEIDHSPG
FTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALL
IENTSPDDYGQYECVVRNSLGQASTTLEFSKPSRPDAPLQLRVGNVSDTGVDLNWTPGFD
GGMQTYFRLRLKQHGEDKYKYVDAKPGHQNISLDGLKPGATYYFSVMAANEAGGSKFMPD
IKLTLSKGSQPHSAEYTEKDELPNVMIIGITSAAMVLLVLNAALVAWFVIRRQNKSQSEA
EPSNDDVYSKDDSQSVYKLPITALQADVQKKAAASTYLVENVDIIQSTAYPPKYQESSMC
TPPYPLCNPDFTRTLPNPKRHSQRNSATGMIEGMQMRSKDDHMLISNGLYIPSPSPASSL
VIKGSYISSPSPAPPADGSYFNMSDKYMSYPPVTY
Download sequence
Identical sequences A1Z9X4
FBpp0086544 NP_001286439.1.81976 NP_788355.1.81976 FBpp0086545 7227.FBpp0086545 FBpp0086545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]