SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086669 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086669
Domain Number 1 Region: 371-738
Classification Level Classification E-value
Superfamily L domain-like 5.53e-60
Family Internalin LRR domain 0.015
Further Details:      
 
Domain Number 2 Region: 176-404
Classification Level Classification E-value
Superfamily L domain-like 6.05e-39
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 3 Region: 669-905
Classification Level Classification E-value
Superfamily RNI-like 4.16e-34
Family 28-residue LRR 0.02
Further Details:      
 
Domain Number 4 Region: 101-210
Classification Level Classification E-value
Superfamily L domain-like 0.00000000403
Family Ngr ectodomain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086669   Gene: FBgn0261269   Transcript: FBtr0087540
Sequence length 1092
Comment pep:known chromosome:BDGP5:2R:10158306:10162377:1 gene:FBgn0261269 transcript:FBtr0087540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQLRLRTLVLLHFIALASSEYVYGEPEFKCPKKSKALYPCECVKGSDNGLYIRCENTNL
ATLSVALQNLASFGMPIEELTIYRGHFVRLYGPLFAHIKARMLIIEETPLATIEDYVFYG
VNNTLEQLHLLRTNLSHVGLLGFGILGKAKELVIDGHAFQQLPKDLFAGQEIANSLGIIR
VTNGNLSDLPIETFQPLRKLKTLDLHGNQLENLKRNQFKNLRELEVLDISHNQIKKLEAQ
HIADLTKLGWCNVSHNALSELSRGTFARNSVLKVLHLSHNQIARLDANSFRGMRFLRRLF
LSDNVLTDIGRGTFGSIARIGTIDLARNRLKKIEFQMFTQMNYVELLDLAENNITKIEKN
SFKDIYQAIINVSHNALELIETAAFENCVNITVLDLSHNRLANFSRRSFDETTFATYFQL
SYNNLTNLAQIPIQNMTGLKVLNASYNSITEIPKNCFPKLYELHTIDVSHNNISSIFNGV
FQTLFSLRSIDLSHNSMREIKSSTFGTLPTLLEMDLSHNELVSVVRGSLAKLTSLRQLYL
NNNQLEKLFQLPISLNELYFSHNRLTNIPSGTWPVMNSLIYLDLSHNQLGDTLNGESFTG
LLVVQRLKLQNNGISQPPKDAVAVMSTLQYLHLENNNITTLERSAFGKLPVLFELNLYGN
QVKDISKRAFEGLLQLLTLNLSSNGIQTLQNDIFVGLPSLRNLDLSFNSLTKLDNKTNGV
LDDLLSLETLDLSHNRISFVTKKTFPSHQYIPYNLRNLNLSYNLMPILTYDITFGTKKLV
RLDVSHNQINDLRRGVISNFTSLQSLDMSYNELSNLKSEEHIFDLPQNLSWLDLSHNKIY
HLPFANLVKVKSLKYVDLTNNSLEDVPASIVGSMRNGSQVLLAGNPLHCGCNARPLKYFM
LQQTIAGEDLKSIYCGTPALIKDKQLISLDDEYLHCAEDEQEMYKGIDYEQLTDVRFREV
KTNKAGMLTLCWYVSGFSDVSDFHVYIRSSSNDVLHQSDYAYNNRTAQIPVEELSTLGEE
KLRGAEICIVSRDSDGNTRKWFSGQCQQLPSLKRPRTFFFGNFQVRGGVSRTSSSLPRCL
LYIILVLFVARL
Download sequence
Identical sequences A1Z9N6
FBpp0086669 FBpp0086669 NP_001286416.1.81976 NP_610948.2.81976 FBpp0086669 7227.FBpp0086669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]