SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086712 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086712
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily UBC-like 3.43e-22
Family RWD domain 0.0015
Further Details:      
 
Domain Number 2 Region: 117-192
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000206
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086712   Gene: FBgn0033884   Transcript: FBtr0087586
Sequence length 374
Comment pep:known chromosome:BDGP5:2R:9749517:9751661:1 gene:FBgn0033884 transcript:FBtr0087586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALQDEVESLEAILMDDVCIKRTPSGEVEQIETTVLPLTGEEEEQQYVCVTLQVHPTPG
YPEESPTFKLLRPRGLDDARLEAIRSACNAKIKESIGFPVVFDLIEVVREHLSGSNLPSG
QCVVCLYGFADGDEFTRTECFHYLHSYCLARHLNALRRNYQEEFDKLPAWLQKTADPFQA
LCPVCREHIGDETDSLKCAMPPSELLNAPEFKVTEELRQMQQRMSELYLQQKSRGAIIDV
NAEGSAVISIETEEDIRRRRRREEAEAAKKLEGPSKEEVIKPTTSSTFAPVVQETHRIMP
EPTNNNYHHNRRHYRGGRRHHHHHQHGHHHRAERERGEQNAAAAPANAGGSTSNAVNTNS
KQAKAQSASSGLAR
Download sequence
Identical sequences A1Z9I6
7227.FBpp0086712 NP_001027416.2.81976 NP_610915.2.81976 FBpp0086712 FBpp0086712 FBpp0086712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]