SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086803 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086803
Domain Number 1 Region: 141-461
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.96e-84
Family NAD kinase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086803   Gene: FBgn0053156   Transcript: FBtr0087683
Sequence length 490
Comment pep:known chromosome:BDGP5:2R:9434650:9438952:-1 gene:FBgn0053156 transcript:FBtr0087683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSDIDLATLHENRLEQRWHYGLPNSHHIYHQHHYHHVGFSAMTRLCLERNLQRKVQPD
HNGNCLARGRSRENANAIDSSSSGGGRRRRSGTWPRTRSLNAPSPVQQFGPCGRIMKNSA
MVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLAPFVYLVDWLLQEKNMVVWVESAVLE
DVQLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASLLFQQSVPPVMAF
HLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRLRCVMHRRSDRKHEAKTLEADLDGE
ARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAAAAG
ASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESRNTSWVSFDGRNRQELFH
GDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKRQKCLDELSDLTASGSEDTLD
EIENMKLYDV
Download sequence
Identical sequences A1Z9F4
7227.FBpp0086803 NP_788346.1.81976 FBpp0086801 FBpp0086803 FBpp0086803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]