SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086837 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086837
Domain Number 1 Region: 85-394
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.38e-66
Family gamma-Butyrobetaine hydroxylase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086837   Gene: FBgn0033830   Transcript: FBtr0087720
Sequence length 402
Comment pep:known chromosome:BDGP5:2R:9263476:9265219:-1 gene:FBgn0033830 transcript:FBtr0087720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQADRRDLPSQPLKLALPKEQDQSRLVQVPDPDRRDMQFPDIWLRDNCRCEECYLPQTL
SRLPQLWNHLDTSVRVLRQSVDVDQRVLCIEWSDGHTSQYPFSWLRERDFSYANRQRYLR
DFYRPEQKLWSGLDFEKIRQVFYYQELLDCDSALQQWLQHLAVYGVAMVKEAPLDMDVLR
RLSNRVGFMRRTTYGEEFSVRAQPGGSNYAYLAAPLPLHTDMPYFEYLPGVTMLHTLEQS
ASPGGVNLLADAFYVAEVMRERYPEQFRVLCQTPVDWADIGSDGDLQFHNIWRAPVINLD
AEGRCVRINHSIPQRDSHFSVPVEQVRPWYEAMATFVGLAHEHSCRFKTTPGDVLTFDNL
RLVHGRTGYDDTDRNVRHILGAFVDWDIVYSRLRVLRNAKAT
Download sequence
Identical sequences Q7K4A8
FBpp0086837 FBpp0086837 NP_610868.1.81976 FBpp0086837 7227.FBpp0086837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]