SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086903 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086903
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-26
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 447-502
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000873
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086903   Gene: FBgn0033785   Transcript: FBtr0087790
Sequence length 516
Comment pep:known chromosome:BDGP5:2R:8824400:8827917:1 gene:FBgn0033785 transcript:FBtr0087790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDRFHKAAKDGLLDVLAAATRKDTNAKDSDSMTPVMWAAFEGRLDALRLLCGRGGDPD
KCDQFGNTALHLASAKGHLHCVDFLVKFGVNIYALDIDKHSAKDLAAINGRDEILRYLDV
AFTNFEATEKKKSKALKELAEKNCEKRVREYMKRQNQQQQRQDPEYSDLSAPSGSSKTGN
MLSTLKQKIWSSQGNLNKTPRDTPPPTKFSDLVGNGSSSSGGSTIASRAGTVQKRPSQLQ
KQHSSTCPHSKISSDTDGGFKVREVEPDGKRTITSLTGLQRDSEVLYVGTFSSNEDSVGK
RGKISDVFECMEADELDHSDNRSGYSSTLARSFSQPDILGDGQLTQELSEEVTLQRPVGL
FDRPTMLGSIAFRRSVTAALSQLQLHTDTSSTSTMRNAGSNPPKTRNGGGKGRLYLNLSD
DTDSEGGGHDIYSDDDDDDRDAGGSALQRFLAVWALEEYLPVFQKQEIDLETLMLLTESD
LKSLGLPLGPFRKLTFAIQERRNALANPGPLVDSRL
Download sequence
Identical sequences Q7JQL2
7227.FBpp0086904 FBpp0086903 FBpp0086904 NP_610829.1.81976 NP_788340.1.81976 FBpp0086903 FBpp0086904 FBpp0086903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]