SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086919 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086919
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000106
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.008
Further Details:      
 
Domain Number 2 Region: 649-694
Classification Level Classification E-value
Superfamily RING/U-box 0.000000751
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 597-633
Classification Level Classification E-value
Superfamily SAP domain 0.00000305
Family SAP domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086919   Gene: FBgn0033783   Transcript: FBtr0087806
Sequence length 700
Comment pep:known chromosome:BDGP5:2R:8818417:8821550:-1 gene:FBgn0033783 transcript:FBtr0087806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCESCGVEFTVFRRKRACFDCKRYYCANCIASRRCKRCSVFAQRPLSRTDLLKLKPKDL
IFYLQSKHISTEGCLEKEELVGLVLTHVAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQ
NFFSNLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQ
HVHVQQQATTTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDC
ECSDEEIMATFSERVSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPG
SSSSKADASSQSSFEELGAIGGISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSA
ADEILEVTLRSRPAVEGDDSEMGESTQALNVNQRPANPSPAFYPAVPQRTKKVTRRRSDG
YLNRRYHSSDDESPVAPGGPGLSLGLSTLSEHPEHGLHPHSHRQSCQRCGKNKTNIRRHV
EKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKSVDASDADSHAVSPLSVDAISVAAGGR
SPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEPTAGIDSRFVNLEDFEDLKDLE
GLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAVEKLATDELCKICMDAP
IECVFLECGHMATCTSCGKVLNECPICRQYIVRVVRFFRA
Download sequence
Identical sequences A1Z971
NP_001286365.1.81976 NP_610827.2.81976 FBpp0086919 7227.FBpp0086919 FBpp0086919 FBpp0086919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]