SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086941 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086941
Domain Number 1 Region: 26-236
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.86e-59
Family BAR domain 0.00000000255
Further Details:      
 
Domain Number 2 Region: 533-601
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-16
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086941   Gene: FBgn0027356   Transcript: FBtr0087828
Sequence length 602
Comment pep:known chromosome:BDGP5:2R:8481109:8499573:1 gene:FBgn0027356 transcript:FBtr0087828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENKGIMLAKSVQKHAGRAKEKILQNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEF
NNYIRCVRAAQAASKTLMDSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIP
LNTYTGQFPEMKKKVEKRNRKLIDYDGQRHSFQNLQANANKRKDDVKLTKGREQLEEARR
TYEILNTELHDELPALYDSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATES
QRGSNTLRKQTSNPIKTSSPVQSPVNKLNNANINSNYQNQITTNGGSSLANSPTSTSSSL
QEPRFDSVSSTPEPRPESPAAALVSATPSSPVENGVTTKSLERPELSGLNASAKATTTTQ
TSPTEDKAVVSEAVKPSETEGAAVAASVTPAPPATPAQINGNNNEPSIVKEGGKQPKELP
STTSNAEAAAEAAANNGNSIEEHKQKKLGNDTTVTATETVTVTQHSVTSTDTDNIVTISD
TNTDTDTKTSTGTSQKGRPVPVVNRHSVNNLNKNPFEDDDERIYEVPADANTADLPPGVL
YRVKATYGYAKEDVDELSFEIGDLIRVIEYDDPEDQEEGWLMGQKEGTNEKGLFPANFTR
PI
Download sequence
Identical sequences Q7KLE5
FBpp0086941 FBpp0086941 FBpp0086941 NP_523717.1.81976 7227.FBpp0086941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]