SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0086966 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086966
Domain Number 1 Region: 202-522
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.71e-52
Family Diacylglycerol kinase-like 0.011
Further Details:      
 
Domain Number 2 Region: 97-167
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0056
Further Details:      
 
Weak hits

Sequence:  FBpp0086966
Domain Number - Region: 43-81
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0297
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086966   Gene: FBgn0020930   Transcript: FBtr0087853
Sequence length 534
Comment pep:known chromosome:BDGP5:2R:8645051:8647226:1 gene:FBgn0020930 transcript:FBtr0087853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIGTIELSVEALIGSLLALSILFAFCRSLLSEDFVSTFKTRHSWKSIKVLEQACFCNVC
EILLTPSAGLFCDCCGLCTHATPPCQRRADREYRCKDKWLRNESSVRHLWVHGNLPMGVH
CADCNEEVDHHVSTDPGLYGWRCAWCQRCYHNDCYTRADSMEACDLGEFKDMIFPPYSFV
AARTRDSMRLHLASITPPDIENWEPLIVIANTKSGSSTGANVLSLLRGYLHPLQVMELGS
RGPQDALQWAAKASPRPCRILVAGGDGTIGWVLNTIYTLNIKPQPSVAIMPLGTGNDLSR
VLGWGAEPPSVLDPVKILRSIRRARSVNLDRFDLQIEKLHYRLPIQRHPTKTIHVYNYFS
VGVDAYITYNFHKTRESRFYLLSSRIFNKLLYFTFGTQQVMQPGCEHIEEKLTLYLDNKP
VQLPELQALVFLNIDSWGAGCKLCELSNANGEVRIVNSISDGMMEVFGIVSSFHIAQLQC
NISKPVRIGQAKQIRLQVKETVPMQADGEPWMQSPADIRLSSRSQARVLKLAAT
Download sequence
Identical sequences Q7K579
FBpp0086966 FBpp0086966 NP_001286362.1.81976 NP_725228.1.81976 7227.FBpp0086966 FBpp0086966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]