SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087041 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087041
Domain Number 1 Region: 24-142
Classification Level Classification E-value
Superfamily EF-hand 6.8e-35
Family EF-hand modules in multidomain proteins 0.0037
Further Details:      
 
Domain Number 2 Region: 143-236
Classification Level Classification E-value
Superfamily EF-hand 7.71e-26
Family EF-hand modules in multidomain proteins 0.012
Further Details:      
 
Domain Number 3 Region: 218-300
Classification Level Classification E-value
Superfamily RING/U-box 4.94e-19
Family ZZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087041   Gene: FBgn0033739   Transcript: FBtr0087930
Sequence length 623
Comment pep:known chromosome:BDGP5:2R:8324840:8340421:1 gene:FBgn0033739 transcript:FBtr0087930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEVVFGRGMELEPRVAILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIE
AFRENGLNTLEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVPVDSKAGLLLNWLLAAYT
SDNSGKIRVFSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAA
VYESPTFHYKEGLEEEIFPAENKVTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHP
TVCSVCHKENFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEYSSYKSPSKQIG
HSLRKSFRCVPEKTVQVLPRFPDQPEKTLNLSHIVPPSPLPSHNGFSDPSGLVHGHHGPH
PGLPGQHGLFDRSSTLDSRATGRSLDSASGTAGTTMSRVAAASANDEEHRLIARYAARLA
QENRAPSNLPDNATPIGTDNSRAQRELIAQLESKNKEIMREIARLRRQQETEQMAPENPA
LINELRALRQRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGK
SPPMPGGAGILGTSPMSALHAQQMQQHPMAGGVRASQQQLLQQQQQQAHGHGPFSQSQLE
QLNQISSDMRSAFAANGSASKCE
Download sequence
Identical sequences A1Z904
FBpp0087041 FBpp0087041 NP_725172.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]