SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0087051 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0087051
Domain Number 1 Region: 366-451
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.07e-17
Family PWWP domain 0.0032
Further Details:      
 
Domain Number 2 Region: 565-606
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000068
Family MYND zinc finger 0.013
Further Details:      
 
Domain Number 3 Region: 290-357
Classification Level Classification E-value
Superfamily Bromodomain 0.00000301
Family Bromodomain 0.0091
Further Details:      
 
Weak hits

Sequence:  FBpp0087051
Domain Number - Region: 83-112
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0135
Family PHD domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0087051   Gene: FBgn0033752   Transcript: FBtr0087940
Sequence length 608
Comment pep:known chromosome:BDGP5:2R:8406654:8409131:1 gene:FBgn0033752 transcript:FBtr0087940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDIPPSAIRIWMDKLKKGVGQPATVLERSLLNLMSAEAASLSVKNATERGILVARAGG
GRSKRLALAFCQKVSRLPSSPIDPFCFECHLPGAVKKCISCHRSFHENCQRQDPEKPNYS
VPSDKGQPYQFPVNELDNQPLNNTQNLETPQTPTPLLDHNSNINQTLLATTDFLKHENIE
WDDDVFFVCEQKGARQRKLPRIKDELQSSLDSDEGSDLERCTHCRLLALAALHNPPQLDK
QELGCLLKYSWDQHHSWISMDVAKYMAKHWNERDKALVKRLLFKTKILGLGDIERNIAAA
KYTYLTEFLMDLLDLQHNMAVFFGQKSVEYNATKWLMRDVTHDIREIRRCPDCYRYSNEA
SLSDLWFAKPCLQRHELVFAKQVGSPPWPAKVMSVSKRQPIKYDVRFFGGTHSRALISER
DITPIESDIQSHIKPRNSRALSAAIKELQCHMMLSHYSASLFGFHADPTVAENLIKVALS
HCTESTETSASGKRGRPPTPATPGAAKNRRLNNTTSNTSSPVPIRGIPDSVAYDSLTAEI
LQAHNDLLNCRRELSATQRKLAEVKRKQWCYHCLDEAVFNCCFTASYCSVECQRRDKRRH
QASCKVTH
Download sequence
Identical sequences Q7K264
FBpp0087051 FBpp0087051 7227.FBpp0087051 NP_610795.1.81976 FBpp0087051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]